Animal-Free GRO-alpha/CXCL1 Protein, Human (His)

GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. Animal-Free GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived animal-FreeGRO-alpha/CXCL1 protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

GRO-alpha/CXCL1 protein exhibits chemotactic activity for neutrophils and may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. In vitro studies indicate that processed forms of GRO-alpha, namely GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), display a significantly enhanced chemotactic activity, being 30-fold higher compared to the full-length protein.

Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <3 ng/mL.

Human

E. coli

N-6*His

P09341 (A35-N107)

2919  [NCBI]

Full Length of Mature Protein

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.