Animal-Free HMGB2/HMG-2 Protein, Human (His)

The multifunctional HMGB2/HMG-2 protein exhibits multiple cellular functions and may function in a redox-sensitive manner. In the nucleus, it acts as a chromatin-associated non-histone protein that is essential for transcription, chromatin remodeling and V(D)J reorganization. Animal-Free HMGB2/HMG-2 Protein, Human (His) is the recombinant human-derived animal-FreeHMGB2/HMG-2 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

HMGB2/HMG-2, a versatile protein with diverse cellular functions across various compartments, may act in a redox-sensitive manner. In the nucleus, it serves as an abundant chromatin-associated non-histone protein, playing crucial roles in transcription, chromatin remodeling, and V(D)J recombination, among other processes. HMGB2/HMG-2 exhibits a DNA-binding preference for non-canonical DNA structures, such as single-stranded DNA, and possesses the ability to bend DNA, enhancing flexibility through looping. This looping mechanism facilitates the promotion of activities on various gene promoters by augmenting transcription factor binding and bringing distant regulatory sequences into close proximity. Involved in V(D)J recombination, HMGB2/HMG-2 acts as a cofactor of the RAG complex, stimulating cleavage and RAG protein binding at the conserved recombination signal sequences. Additionally, it is proposed to participate in the innate immune response to nucleic acids by acting as a promiscuous immunogenic DNA/RNA sensor, cooperating with subsequent discriminative sensing by specific pattern recognition receptors. In the extracellular compartment, HMGB2/HMG-2 acts as a chemokine, promoting proliferation and migration of endothelial cells and exhibiting antimicrobial activity in gastrointestinal epithelial tissues. It is implicated in inflammatory responses to antigenic stimuli and involved in the modulation of neurogenesis, likely by regulating neural stem proliferation. Furthermore, HMGB2/HMG-2 contributes to articular cartilage surface maintenance through interactions with LEF1 and the Wnt/beta-catenin pathway. It interacts with various proteins, including POU2F2, POU2F1, POU3F1, SET, and LEF1, highlighting its intricate role in diverse cellular processes.

Human

E. coli

C-6*His

P26583 (M1-E209)

3148  [NCBI]

Full Length

MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE

Approximately 24.84 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.