1. Recombinant Proteins
  2. Cytokines and Growth Factors Animal-free Recombinant Proteins
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-1
  5. IL-1 beta
  6. Animal-Free IL-1 beta Protein, Pig (His)

Animal-Free IL-1 beta Protein, Pig (His)

Cat. No.: HY-P700243AF
COA Handling Instructions

IL-1 beta Protein, a potent pro-inflammatory cytokine, initiates various immune responses, including prostaglandin synthesis, neutrophil recruitment, T-cell cytokine production, B-cell activation, fibroblast proliferation, and collagen production. It promotes Th17 differentiation, synergizes with IL12 for IFNG synthesis by Th1 cells, and induces angiogenesis along with TNF and IL6. Involved in pyroptosis, its mature form is released through the GSDMD pore. Additionally, IL-1 beta Protein interacts with ASFV protein L83L during microbial infections. Animal-Free IL-1 beta Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 beta protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Pig (His) is 153 a.a., with molecular weight of ~18.51 kDa.

Animal-free recombinant proteins offer high consistency and stability, whithout using or contacting of any animal-derived materials and reagents.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $85 In-stock
10 μg $230 In-stock
50 μg $650 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-1 beta Protein, a potent pro-inflammatory cytokine, initiates various immune responses, including prostaglandin synthesis, neutrophil recruitment, T-cell cytokine production, B-cell activation, fibroblast proliferation, and collagen production. It promotes Th17 differentiation, synergizes with IL12 for IFNG synthesis by Th1 cells, and induces angiogenesis along with TNF and IL6. Involved in pyroptosis, its mature form is released through the GSDMD pore. Additionally, IL-1 beta Protein interacts with ASFV protein L83L during microbial infections. Animal-Free IL-1 beta Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 beta protein, expressed by E. coli, with C-His labeled tag. The total length of Animal-Free IL-1 beta Protein, Pig (His) is 153 a.a., with molecular weight of ~18.51 kDa.

Background

IL-1 beta Protein is a potent pro-inflammatory cytokine that was initially discovered as a major endogenous pyrogen. It triggers various immune responses, including the synthesis of prostaglandins, recruitment and activation of neutrophils, activation and production of cytokines by T-cells, activation of B-cells leading to antibody production, and stimulation of fibroblast proliferation and collagen production. Additionally, it plays a role in promoting Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis by Th1 cells. IL-1 beta Protein also contributes to angiogenesis by synergistically inducing VEGF production along with TNF and IL6. Moreover, it is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. IL-1 beta Protein also interacts with African swine fever virus (ASFV) protein L83L during microbial infections.

Biological Activity

Measure by its ability to induce D10.G4.1 cells proliferation. The ED50for this effect is <3 ng/mL.

Species

Pig

Source

E. coli

Tag

C-His

Accession

P26889 (A115-P267)

Gene ID
Molecular Construction
N-term
IL-1β (A115-P267)
Accession # P26889
His
C-term
Synonyms
Interleukin-1 beta; IL-1β; IL1F2; IL-1 beta; IL1B
AA Sequence

MANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Molecular Weight

Approximately 18.51 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a solution containing 1X PBS, pH 7.4.

Endotoxin Level

<0.1 EU per 1 μg of the protein by the LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Animal-Free IL-1 beta Protein, Pig (His)
Cat. No.:
HY-P700243AF
Quantity:
MCE Japan Authorized Agent: