Animal-Free IL-1 beta Protein, Pig (His)

IL-1 beta protein is a potent proinflammatory cytokine that initiates various immune responses, including prostaglandin synthesis, neutrophil recruitment, T cell cytokine production, B cell activation, fibroblast proliferation, and collagen produce. It promotes Th17 differentiation, synergizes with IL12 to promote IFNG synthesis by Th1 cells, and induces angiogenesis together with TNF and IL6. Animal-Free IL-1 beta Protein, Pig (His) is the recombinant pig-derived animal-FreeIL-1 beta protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

IL-1 beta Protein is a potent pro-inflammatory cytokine that was initially discovered as a major endogenous pyrogen. It triggers various immune responses, including the synthesis of prostaglandins, recruitment and activation of neutrophils, activation and production of cytokines by T-cells, activation of B-cells leading to antibody production, and stimulation of fibroblast proliferation and collagen production. Additionally, it plays a role in promoting Th17 differentiation of T-cells and synergizes with IL12 to induce IFNG synthesis by Th1 cells. IL-1 beta Protein also contributes to angiogenesis by synergistically inducing VEGF production along with TNF and IL6. Moreover, it is involved in the transduction of inflammation downstream of pyroptosis, where its mature form is specifically released into the extracellular space through the gasdermin-D (GSDMD) pore. IL-1 beta Protein also interacts with African swine fever virus (ASFV) protein L83L during microbial infections.

Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀for this effect is <3 ng/mL.

Pig

E. coli

C-6*His

P26889 (A115-P267)

397122  [NCBI]

Full Length of Mature Protein

ANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.