Animal-Free IL-1RA/IL-1RN Protein, Human (His)

IL-1RA/IL-1RN proteins are potent anti-inflammatory antagonists in the interleukin 1 family, specifically targeting the proinflammatory cytokines IL1B and IL1A. It protects against immune dysregulation and, crucially, prevents IL1 from triggering uncontrolled systemic inflammation in response to various innate stimulants, including pathogens. Animal-Free IL-1RA/IL-1RN Protein, Human (His) is the recombinant human-derived animal-FreeIL-1RA/IL-1RN protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

The IL-1RA/IL-1RN protein stands as a potent anti-inflammatory antagonist within the interleukin-1 family, specifically targeting proinflammatory cytokines like interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Serving as a safeguard against immune dysregulation, this protein is instrumental in preventing uncontrolled systemic inflammation triggered by IL1 in response to various innate stimulatory agents, including pathogens. Its nature underscores its utility in research and therapeutic applications, providing a reliable and ethical tool for studying and mitigating inflammatory processes without reliance on animal-derived materials.

Measure by its ability to inhibit IL-1 alpha-dependent proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <50 ng/mL.

Human

E. coli

C-6*His

P18510-1 (R26-E177)

3557  [NCBI]

Full Length of Isoform-1 Mature Protein

RPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.