Animal-Free IP-10/CXCL10 Protein, Pig (His)

The IP-10/CRG-2/CXCL10 protein is part of the intercrine α family and functions as a chemokine involved in intercellular communication and immune responses. Further studies may contribute to the regulation of inflammatory processes and cellular interactions and will be critical to uncovering specific functions and effects within the broader CxC family of chemokines. Animal-Free IP-10/CXCL10 Protein, Pig (His) is the recombinant pig-derived animal-FreeIP-10/CRG-2/CXCL10 protein, expressed by E. coli , with N-His labeled tag.This product is for cell culture use only.

The IP-10/CRG-2/CXCL10 protein is a member of the intercrine alpha (chemokine CxC) family, emphasizing its role within a group of chemokines implicated in intercellular communication and immune responses. As part of the intercrine alpha family, IP-10/CRG-2/CXCL10 likely contributes to the modulation of inflammatory processes and cellular interactions. Further investigation is essential to unveil the specific functions and implications of this protein within the broader framework of the chemokine CxC family.

Measure by its ability to chemoattract BaF3 cells transfected with Human CXCR2.The ED₅₀ for this effect is <4 ng/mL.

Pig

E. coli

N-6*His

Q5S1S3 (P23-A104)

494019  [NCBI]

Full Length of Mature Protein

PLSRTVRCTCIKISDRPVNPRSLEKLEMIPASQSCPHVEIIATMKKNGEKRCLNPESKTIKNLLKAISKERSKRSPRTQREA

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.