Animal-Free TGF beta 1/TGFB1 Protein, Human (His)

TGF beta 1/TGFB1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. Animal-Free TGF beta 1/TGFB1 Protein, Human (His) is the recombinant human-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Transforming growth factor (TGF) beta 1 is a polypeptide member of the transforming growth factor beta superfamily of cytokines. TGF beta 1 is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation, apoptosis, and can regulate the expression and activation of other growth factors, including interferon gamma and tumor necrosis factor alpha. In humans, TGF-β1 is encoded by the TGFB1 gene. TGF beta 1 activates CREB3L1 by regulating intramembranous proteolysis, stimulating sustained collagen production. TGF beta 1 mediates SMAD2/3 activation by inducing SMAD2/3 phosphorylation and subsequent translocation to the nucleus and regulates dental papilla cells by promoting IPO7-mediated translocation of phosphorylated SMAD2 to the nucleus and subsequent transcription of target genes. TGF beta 1 induces epithelial-to-mesenchymal transition (EMT) and cell migration in various cell types.TGF beta 1 plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages^{[1][2][3][4][5][6]}.

1.Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL. The specific activity of recombinant human TGF beta 1 is approximately >5 x 10⁷ IU/mg.
2.Measure by its ability to induce proliferation in MCF-7 cells The ED₅₀ for this effect is <3.2 ng/mL.

Human

E. coli

C-6*His

P01137 (A279-S390)

7040  [NCBI]

Full Length of Mature TGFB1

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 10 kDa (mature TGFβ1) & 40 kDa (LAP protein) & 50 kDa (inacitve latent TGFβ1), based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a solution containing 1X PBS, pH 8.0 or 20 mM sodium citrate and 0.2 M NaCl, pH 4.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in 10 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ghadami M, et al. Genetic mapping of the Camurati-Engelmann disease locus to chromosome 19q13.1-q13.3. Am J Hum Genet. 2000 Jan;66(1):143-7.

  [2]. Vaughn SP, et al. Confirmation of the mapping of the Camurati-Englemann locus to 19q13. 2 and refinement to a 3.2-cM region. Genomics. 2000 May 15;66(1):119-21.  [Content Brief]

  [3]. Chen Q, et al. Sustained induction of collagen synthesis by TGF-β requires regulated intramembrane proteolysis of CREB3L1. PLoS One. 2014 Oct 13;9(10):e108528.  [Content Brief]

  [4]. Kotlarz D, et al. Human TGF-β1 deficiency causes severe inflammatory bowel disease and encephalopathy. Nat Genet. 2018 Mar;50(3):344-348.  [Content Brief]

  [5]. Hwangbo C, et al. Syntenin regulates TGF-β1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-β type I receptor internalization. Oncogene. 2016 Jan 21;35(3):389-401.  [Content Brief]

  [6]. Letterio JJ, rt al. Regulation of immune responses by TGF-beta. Annu Rev Immunol. 1998;16:137-61.  [Content Brief]