Animal-Free TGF beta 1/TGFB1 Protein, Mouse/Rat (His)

In its proprotein form, the TGF beta-1/TGFB1 protein serves as a precursor to latency-associated peptide (LAP) and active transforming growth factor beta-1 (TGF-beta-1) chains.Critical to maintaining the latent state of TGF-β-1 within the extracellular matrix, preprotein interacts with “environmental molecules” such as LTBP1, LRRC32/GARP, and LRRC33/NRROS to regulate TGF-β-1 activation.Animal-Free TGF beta 1/TGFB1 Protein, Mouse/Rat (His) is the recombinant mouse-derived animal-FreeTGF beta 1/TGFB1 protein, expressed by E.coli , with C-His labeled tag.This product is for cell culture use only.

The TGF beta-1 (TGFB1) protein, in its proprotein form, serves as a precursor for both the Latency-associated peptide (LAP) and the active Transforming growth factor beta-1 (TGF-beta-1) chains. This proprotein is crucial for maintaining the TGF-beta-1 chain in a latent state during storage within the extracellular matrix. The interaction with various 'milieu molecules,' including LTBP1, LRRC32/GARP, and LRRC33/NRROS, plays a pivotal role in regulating the activation of TGF-beta-1. Specifically, LRRC33/NRROS is involved in the activation of TGF-beta-1 in macrophages and microglia, while LRRC32/GARP controls its activation on the surface of activated regulatory T-cells (Tregs). Additionally, the proprotein interacts with integrins (ITGAV:ITGB6 or ITGAV:ITGB8), leading to the distortion of the Latency-associated peptide chain and subsequent release of active TGF-beta-1.

Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells.The ED₅₀ for this effect is<0.1 ng/mL.

Rat; Mouse

E. coli

C-6*His

P04202/P17246 (A279-S390)

21803  [NCBI]/59086

Full Length of Mature TGFB1

ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM sodium citrate, 0.2 M NaCl, pH 3.5, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in 10 mM HCl. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.