Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His)

The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.

The TNF beta Protein, in its homotrimeric form, functions by binding to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, displaying a high degree of similarity in its interactions. In its heterotrimeric form, formed with LTB, it binds to TNFRSF3/LTBR, revealing its versatility in receptor interactions. Produced by lymphocytes, lymphotoxin, the heterotrimeric form of TNF beta, demonstrates cytotoxicity against a broad spectrum of tumor cells both in vitro and in vivo. It exists as homotrimeric and heterotrimeric complexes, with the latter composed of either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Notably, TNF beta interacts with TNFRSF14, further contributing to its diverse immunomodulatory functions.

The ED₅₀ is <30 ng/mL as measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D.

Mouse

E. coli

N-6*His

P09225 (L34-L202)

16992  [NCBI]

Full Length of Mature Protein

LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL

Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.

<0.1 EU per 1 μg of the protein by the LAL method.

It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.