Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His)
Based on 1 Customer Validation
The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The animal-free TNF beta protein acts as a homotrimeric cytokine that binds TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM.Animal-Free TNF-beta/TNFSF1 Protein, Mouse (His) is the recombinant mouse-derived animal-FreeTNF beta protein, expressed by E.coli , with N-His labeled tag.This product is for cell culture use only.
Background
The TNF beta Protein, in its homotrimeric form, functions by binding to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, displaying a high degree of similarity in its interactions. In its heterotrimeric form, formed with LTB, it binds to TNFRSF3/LTBR, revealing its versatility in receptor interactions. Produced by lymphocytes, lymphotoxin, the heterotrimeric form of TNF beta, demonstrates cytotoxicity against a broad spectrum of tumor cells both in vitro and in vivo. It exists as homotrimeric and heterotrimeric complexes, with the latter composed of either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Notably, TNF beta interacts with TNFRSF14, further contributing to its diverse immunomodulatory functions.
Verified Bioactivity
The ED50 is <30 ng/mL as measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P09225 (L34-L202)
-
Molecular Construction
-
N-term
-
6*His
-
TNF beta (L34-L202)
Accession # P09225 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LTA; Lymphotoxin Alpha (TNF Superfamily, Member 1); Prev. TNFB; Lymphotoxin Alpha Transcript Variant 4; TNFSF1; Lymphotoxin Alpha Transcript Variant 3; Tumor Necrosis Factor Ligand Superfamily Member 1; Tumor Necrosis Factor Ligand 1E; Lymphotoxin-Alpha;
-
AA Sequence
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
-
Predicted Molecular Mass
19.4 kDa
-
Molecular Weight
Approximately 11-17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, trehalose.
<0.1 EU per 1 μg of the protein by the LAL method.
It is recommended to reconstitute to a concentration of 100-200 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
