Animal-Free TNF-beta/TNFSF1 Protein, Human (His)

TNF-β protein acts as a homotrimeric cytokine that binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM. Animal-Free TNF-beta/TNFSF1 Protein, Human (His) is the recombinant human-derived animal-FreeTNF-beta/TNFSF1 protein, expressed by E. coli , with N-His labeled tag. The total length of Animal-Free TNF-beta/TNFSF1 Protein, Human (His) is 171 a.a., with molecular weight of ~18.65 kDa.

TNF-beta Protein, in its homotrimeric configuration, exhibits binding capabilities to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR, and TNFRSF14/HVEM, as demonstrated by various studies. Additionally, in its heterotrimeric association with LTB, it forms interactions with TNFRSF3/LTBR, underscoring its diverse receptor engagement. This cytokine, primarily produced by lymphocytes, showcases cytotoxic effects against a broad array of tumor cells both in vitro and in vivo. Structurally, TNF-beta exists as both homotrimers and heterotrimers, the latter comprising either two LTB and one LTA subunits or, to a lesser extent, two LTA and one LTB subunits. Furthermore, TNF-beta engages in interactions with TNFRSF14, emphasizing its pivotal role in mediating intricate immunological responses.

Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED₅₀ for this effect is <3 pg/mL. The specific activity of recombinant human TNF beta is > 3.3x10⁸ IU/mg.

Human

E. coli

N-His

P01374 (L35-L205)

4049  [NCBI]

LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL

Approximately 18.65 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a solution containing 20 mM sodium citrate, 0.2 MNaCl, pH 3.5.

<0.1 EU per 1 μg of the protein by the LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.