Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc)

The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Apolipoprotein A-I/APOA1 Protein, Mouse (246a.a, HEK293, Fc) is 246 a.a., with molecular weight of ~58 kDa.

Apolipoprotein A-I (APOA1) Protein plays a pivotal role in the reverse transport of cholesterol, facilitating its efflux from tissues and functioning as a crucial cofactor for lecithin cholesterol acyltransferase (LCAT) to promote cholesterol excretion from tissues to the liver. This protein exists as a homodimer and is part of the sperm activating protein complex (SPAP), which includes APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. APOA1 also interacts with APOA1BP and CLU, contributing to its diverse molecular associations. Additionally, it engages with NDRG1, SCGB3A2, NAXE, and YJEFN3, further highlighting its involvement in various cellular processes beyond cholesterol metabolism, including spermatozoa motility and protein complex interactions.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR. The ED₅₀ for this effect is ≤781.5 ng/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Neuropilin-1 at 2 μg/ml (100 μl/well) can bind Biotinylated human VEGF165.The ED₅₀ for this effect is 0.01063 μg/mL.

Mouse

HEK293

C-hFc

Q00623 (W19-Q264)

11806  [NCBI]

WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Approximately 58 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.