Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)

Apolipoprotein AI plays a key role in reverse cholesterol transport, promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It forms homodimers and participates in the SPAP complex, which is essential for sperm motility, interacting with both NAXE and CLU. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is 243 a.a., with molecular weight of 55-65 kDa.

Apolipoprotein A-I plays a crucial role in the reverse transport of cholesterol by promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It also functions as part of the SPAP complex, activating spermatozoa motility. Apolipoprotein A-I forms homodimers and interacts with NAXE and CLU, while being a component of the SPAP complex, along with an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. Additionally, it interacts with NDRG1, SCGB3A2, and NAXE, as well as YJEFN3.

Human

HEK293

C-hFc

P02647/CAA26097.1 (D25-Q267)

335  [NCBI]

DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

55-65 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.