Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc)

Apolipoprotein AI plays a key role in reverse cholesterol transport, promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It forms homodimers and participates in the SPAP complex, which is essential for sperm motility, interacting with both NAXE and CLU. Apolipoprotein A-I/APOA1 Protein, Human (HEK293, Fc) is the recombinant human-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-hFc labeled tag.

Apolipoprotein A-I plays a crucial role in the reverse transport of cholesterol by promoting cholesterol efflux from tissues and acting as a cofactor for lecithin cholesterol acyltransferase (LCAT). It also functions as part of the SPAP complex, activating spermatozoa motility. Apolipoprotein A-I forms homodimers and interacts with NAXE and CLU, while being a component of the SPAP complex, along with an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. Additionally, it interacts with NDRG1, SCGB3A2, and NAXE, as well as YJEFN3.

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781). The ED₅₀ for this effect is 1.846 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Human MSR (HY-P76781) .The ED₅₀ for this effect is 1.846 μg/mL.

Human

HEK293

C-hFc

P02647/CAA26097.1 (D25-Q267)

335  [NCBI]

Partial

DEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Approximately 55-65 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.