Apolipoprotein A-I/APOA1 Protein, Human (HEK293, His)

Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI^[1][2][3].

Apolipoprotein A1 (ApoA1) is a 28 kDa glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a central role in the reverse transport of cholesterol from peripheral tissues to the liver. In the past decade, reconstituted HDL (rHDL) has been employed as a therapeutic agent for treatment of atherosclerosis. The ability of rHDL to promote cholesterol efflux from peripheral cells has been documented to reduce the size of atherosclerotic plaque lesions^[2].

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR. The ED₅₀ for this effect is <1.2 µg/mL.

• 
  Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Apolipoprotein A‑I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR.The ED₅₀ for this effect is 1.196 µg/mL.

Human

HEK293

C-6*His

P02647 (R19-Q267)

335  [NCBI]

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQHHHHHH

Approximately 32.22 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Ikon N, et al. A facile method for isolation of recombinant human apolipoprotein A-I from E. coli. Protein Expr Purif. 2017 Jun;134:18-24.  [Content Brief]

  [2]. Obici L, et al. Structure, function and amyloidogenic propensity of apolipoprotein A-I. Amyloid. 2006 Dec;13(4):191-205.  [Content Brief]

  [3]. Li Y, et al. Human apolipoprotein A-I is associated with dengue virus and enhances virus infection through SR-BI. PLoS One. 2013 Jul 24;8(7):e70390.  [Content Brief]