Apolipoprotein A-I/APOA1 Protein, Human (HEK293, His)
Based on 3 publication(s) in Google Scholar
Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
-
HY-P701094
Apolipoprotein E/APOE2 Protein, Human (R154S, R176C, HEK293, C-His) -
HY-P73243
Insulin Protein, Human (P.pastoris) -
HY-P7625
B2M/Beta-2-microglobulin Protein, Human (His) -
HY-10627A
GW3965 hydrochloride -
HY-P700292
Prolactin Protein, Human -
HY-P7860
Coagulation Factor X/F10 Protein, Human (HEK293, Fc) -
HY-P701051
Apolipoprotein E/APOE3 Protein, Human (HEK293, hFc) -
HY-P78542A
Apolipoprotein E/APOE4 Protein, Human (C130R, HEK293, Fc)
Biological Activity
Description
Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI[1][2][3].
Background
Apolipoprotein A1 (ApoA1) is a 28 kDa glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a central role in the reverse transport of cholesterol from peripheral tissues to the liver. In the past decade, reconstituted HDL (rHDL) has been employed as a therapeutic agent for treatment of atherosclerosis. The ability of rHDL to promote cholesterol efflux from peripheral cells has been documented to reduce the size of atherosclerotic plaque lesions[2].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Apolipoprotein A-I/ApoA1 at 5 μg/mL (100 μL/well) can bind Biotinylated Recombinant Human SR-AI/MSR. The ED50 for this effect is ≤1.663 µg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Publications (3)
-
Journal Impact Factor
-
Most Recent
-
Cancer Cell
Dissecting genetic and immune drivers of heterogeneous responses to neoadjuvant immunochemotherapy in gastric cancer. [Abstract]2026 Apr 13;44(4):809-830.e11. PMID: 41720086 -
Cell Commun Signal
Neutrophil extracellular traps facilitate liver inflammation/fibrosis progression by entering macrophages and triggering AIM2 inflammasome-dependent pyroptosis. [Abstract]2024 Nov 20;22(1):556. PMID: 39568027 -
Int J Mol Sci
2023 Nov 15;24(22):16363. PMID: 38003549
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P02647 (R19-Q267)
-
Molecular Construction
-
N-term
-
APOA1 (R19-Q267)
Accession # P02647 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOA1; APOA1 Protein; Apolipoprotein A1; Apo(A); Apolipoprotein A-I; HPALP2; Apo-AI; AMYLD3; Epididymis Secretory Sperm Binding Protein; ApoA-I
-
AA Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
-
Molecular Weight
Approximately 27-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 15% trehalose, 0.05% Tween 80, 50 mM methionine, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Ikon N, et al. A facile method for isolation of recombinant human apolipoprotein A-I from E. coli. Protein Expr Purif. 2017 Jun;134:18-24. [Content Brief]
[2]. Obici L, et al. Structure, function and amyloidogenic propensity of apolipoprotein A-I. Amyloid. 2006 Dec;13(4):191-205. [Content Brief]
[3]. Li Y, et al. Human apolipoprotein A-I is associated with dengue virus and enhances virus infection through SR-BI. PLoS One. 2013 Jul 24;8(7):e70390. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
