1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-I/APOA1 Protein, Human

Apolipoprotein A-I/APOA1 Protein, Human

Cat. No.: HY-P7526
Handling Instructions

Apolipoprotein A-I Protein, Human expresses in E. coli. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI[1][2][3].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $160 Ask For Quote & Lead Time
50 μg $490 Ask For Quote & Lead Time

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Apolipoprotein A-I/APOA1 Protein, Human Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Accession

P02647 (R19-Q267)

Gene ID

335

Synonyms
rHuApolipoprotein A-I; ApoA1; Apolipoprotein A-I
AA Sequence

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Molecular Weight

27-29 kDa

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Apolipoprotein A1 (ApoA1) is a 28 kDa glycoprotein that is the major protein component of high density lipoprotein (HDL) particles. HDL particles play a central role in the reverse transport of cholesterol from peripheral tissues to the liver. In the past decade, reconstituted HDL (rHDL) has been employed as a therapeutic agent for treatment of atherosclerosis. The ability of rHDL to promote cholesterol efflux from peripheral cells has been documented to reduce the size of atherosclerotic plaque lesions[2].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-I/APOA1 Protein, Human
Cat. No.:
HY-P7526
Quantity:
MCE Japan Authorized Agent: