Apolipoprotein A-I/APOA1 Protein, Human
Based on 1 publication(s) in Google Scholar
Apolipoprotein A-I/APOA1 Protein is a secreted protein located on the outside of cell membranes and is the main structural apolipoprotein of high-density lipoprotein (HDL), playing a key role in the reverse cholesterol transport pathway. Apolipoprotein A-I/APOA1 protein interacts with the cell surface receptor SR-BI, thereby promoting dengue virus (DV) infection. Apolipoprotein A-I/APOA1 Protein can also activate sperm motility as part of the SPAP complex. Apolipoprotein A-I/APOA1 Protein has anti-inflammatory, anti-atherosclerotic, anti-apoptotic, anti-tumor, and anti-thrombotic functions. Apolipoprotein A-I/APOA1 Protein Protein, Human is made up of 267 amino acids and is expressed in Escherichia coli (E. coli).
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Apolipoprotein A-I/APOA1 Protein is a secreted protein located on the outside of cell membranes and is the main structural apolipoprotein of high-density lipoprotein (HDL), playing a key role in the reverse cholesterol transport pathway. Apolipoprotein A-I/APOA1 protein interacts with the cell surface receptor SR-BI, thereby promoting dengue virus (DV) infection. Apolipoprotein A-I/APOA1 Protein can also activate sperm motility as part of the SPAP complex. Apolipoprotein A-I/APOA1 Protein has anti-inflammatory, anti-atherosclerotic, anti-apoptotic, anti-tumor, and anti-thrombotic functions. Apolipoprotein A-I/APOA1 Protein Protein, Human is made up of 267 amino acids and is expressed in Escherichia coli (E. coli)[1][2][3][4].
Apolipoprotein A-I/APOA1 Protein is one of the most common proteins in human plasma, typically found in amounts of 100-150 mg/dl, with about 80% produced by the liver and 20% by the intestines[3]. The central region of Apolipoprotein A-I/APOA1 Protein (140-170 aa) is mainly associated with the activation of LCAT, while the C-terminal domain (181-243 aa) plays a key role in lipid binding[3]. Apolipoprotein A-I/APOA1 Protein plays a role in the reverse transport of cholesterol from tissues to the liver for excretion by promoting the flow of cholesterol out of tissues and acting as a cofactor for lecithin-cholesterol acyltransferase (LCAT), effectively protecting the body from the accumulation of cholesterol in tissues[1]. When Apolipoprotein A-I/APOA1 Protein interacts with SRB1, cell adhesion molecules are inhibited. This interaction introduces miRNA223 into endothelial cells, which suppresses the expression of ICAM and VCAM on the endothelial membrane and prevents monocytes from adhering to the endothelial cells, thus having an anti-inflammatory effect[3]. Apolipoprotein A-I/APOA1 protein can bridge DV particles and the cell receptor SR-BI, facilitating the attachment of DV to cells, which leads to viral infection[4]. Apolipoprotein A-I/APOA1 Protein is associated with diseases like viral infections, atherosclerosis, diabetes, neurological disorders, and tumors[3][4][5][6].
Apolipoprotein A-I/APOA1 Protein can transport cholesterol to steroidogenic tissues and remove excess free cholesterol from peripheral tissues, esterify it in plasma, and transport it to the liver for excretion[1]. Apolipoprotein A-I/APOA1 Protein (1.68 μg/mL, 30 min) interacts with cell surface receptor SR-BI to enhance the attachment of dengue virus (DV) to human liver cancer cell line Huh-7 and promote viral infection[4]. Apolipoprotein A-I/APOA1 Protein (100 μg/mL, 48 h) can inhibit the cell viability and proliferation of ID8 mouse epithelial cancer cells[6].
Apolipoprotein A-I/APOA1 Protein overexpression in human ApoA-I transgenic mice with apolipoprotein E (Apo E) gene knockout can increase high-density lipoprotein and inhibit atherosclerosis[5]. Apolipoprotein A-I/APOA1 Protein overexpression in human ApoA-I transgenic ovarian cancer mice confers anti-tumor activity[6].
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human APOA1 at 5 µg/mL (100 µL/well) can bind Biotinylated Human MSR (HY-P76781). The ED50 for this effect is 0.3-1.5 μg/mL.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Adv Sci (Weinh)
TREM2-Mediated Cholesterol Efflux in Macrophages Inhibits Anti-Tumor Immunity via Limitation of CD4+ T and NK Cells. [Abstract]2025 Oct 20:e06995. PMID: 41114464
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P02647 (R19-Q267)
-
Molecular Construction
-
N-term
-
APOA1 (R19-Q267)
Accession # P02647 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
APOA1; APOA1 Protein; Apolipoprotein A1; Apo(A); Apolipoprotein A-I; HPALP2; Apo-AI; AMYLD3; Epididymis Secretory Sperm Binding Protein; ApoA-I
-
AA Sequence
RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
-
Predicted Molecular Mass
29 kDa
-
Molecular Weight
Approximately 25-31 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Obici L, et al. Structure, function and amyloidogenic propensity of apolipoprotein A-I. Amyloid. 2006 Dec;13(4):191-205. [Content Brief]
[2]. Akerlöf E, et al. Identification of apolipoprotein A1 and immunoglobulin as components of a serum complex that mediates activation of human sperm motility. Biochemistry. 1991 Sep 17;30(37):8986-90. [Content Brief]
[3]. Bhale AS, et al. Leveraging knowledge of HDLs major protein ApoA1: Structure, function, mutations, and potential therapeutics. Biomed Pharmacother. 2022 Oct;154:113634. [Content Brief]
[4]. Li Y, et al. Human apolipoprotein A-I is associated with dengue virus and enhances virus infection through SR-BI. PLoS One. 2013 Jul 24;8(7):e70390. [Content Brief]
[5]. Plump AS, et al. Human apolipoprotein A-I gene expression increases high density lipoprotein and suppresses atherosclerosis in the apolipoprotein E-deficient mouse. Proc Natl Acad Sci U S A. 1994 Sep 27;91(20):9607-11. [Content Brief]
[6]. Su F, et al. Apolipoprotein A-I (apoA-I) and apoA-I mimetic peptides inhibit tumor development in a mouse model of ovarian cancer. Proc Natl Acad Sci U S A. 2010 Nov 16;107(46):19997-20002. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
