1. Recombinant Proteins
  2. Others
  3. Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution)

Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution)

Cat. No.: HY-P75503
Handling Instructions Technical Support

The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The apolipoprotein AI (APOA1) protein is key to reverse cholesterol transport, promoting tissue efflux, and serves as an important cofactor for lecithin cholesterol acyltransferase (LCAT), promoting cholesterol excretion. As a homodimer, APOA1 is a component of the sperm activating protein complex (SPAP), interacts with APOA1BP, CLU, NDRG1, SCGB3A2, NAXE and YJEFN3, exhibiting multiple molecular associations. Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution) is the recombinant mouse-derived Apolipoprotein A-I/APOA1 protein, expressed by HEK293 , with C-His labeled tag.

Background

Apolipoprotein A-I (APOA1) Protein plays a pivotal role in the reverse transport of cholesterol, facilitating its efflux from tissues and functioning as a crucial cofactor for lecithin cholesterol acyltransferase (LCAT) to promote cholesterol excretion from tissues to the liver. This protein exists as a homodimer and is part of the sperm activating protein complex (SPAP), which includes APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain, and albumin. APOA1 also interacts with APOA1BP and CLU, contributing to its diverse molecular associations. Additionally, it engages with NDRG1, SCGB3A2, NAXE, and YJEFN3, further highlighting its involvement in various cellular processes beyond cholesterol metabolism, including spermatozoa motility and protein complex interactions.

Species

Mouse

Source

HEK293

Tag

C-His

Accession

Q00623 (W19-Q264)

Gene ID
Molecular Construction
N-term
APOA1 (W19-Q264)
Accession # Q00623
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Apolipoprotein L1; Apo-L; ApoL-I; APOL1; APOL
AA Sequence

WHVWQQDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ

Molecular Weight

27-31 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein A-I/APOA1 Protein, Mouse (HEK293, His, solution)
Cat. No.:
HY-P75503
Quantity:
MCE Japan Authorized Agent: