Apolipoprotein A-II/APOA2 Protein, Mouse (HEK293, Fc)

Apolipoprotein A-II/APOA2 protein may stabilize high-density lipoprotein (HDL) structure and affect HDL metabolism through lipid association. As a monomer, APOA2 is critical for maintaining HDL integrity and function. Apolipoprotein A-II/APOA2 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Apolipoprotein A-II/APOA2 protein, expressed by HEK293 , with C-hFc labeled tag.

Apolipoprotein A-II/APOA2 Protein emerges as a potential stabilizer of high-density lipoprotein (HDL) structure through its association with lipids, influencing HDL metabolism. Existing as a monomer, APOA2 may play a crucial role in maintaining the integrity and functionality of HDL particles. Its interactions with NAXE and NDRG1 suggest potential molecular partnerships that may contribute to its regulatory roles in lipid metabolism. The specific mechanisms through which APOA2 influences HDL structure and metabolism, as well as the broader implications of its interactions, remain to be fully elucidated. Comprehensive studies are essential to unravel the precise molecular pathways through which APOA2 modulates HDL dynamics and its potential impact on lipid homeostasis.

Mouse

HEK293

C-hFc

P09813 (A19-K102)

11807  [NCBI]

Full Length of Mature Protein

ALVKRQADGPDMQSLFTQYFQSMTDYGKDLMEKAKTSEIQSQAKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK

40-45 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.