Copy Link Print Information

APOC2 Protein, Human (His, solution)

Customer Review

Based on 1 Customer Validation

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for APOC2 Protein, Human (His, solution)
  • APOC2 Protein, Human (His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Apolipoprotein C-II Protein, Human (His) is expressed in E. coli with a His tag at the N-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the treatment of patients with genetic hypertriglyceridemia caused by ApoC-II otein C-II Protein, Human (His) is expressed in E. coli with 6*His tag at the C-terminus. Apolipoprotein C-II Protein, Human (His) has a pharmacological application for the study genetic hypertriglyceridemia caused by ApoC-II deficiency[1].

Background

APOC2 Protein, Human (His), which is present in chylomicrons, very low density lipoproteins (VLDL), and high density lipoproteins (HDL), is the LPL activator[1].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P02655 (T23-E101)

  • Gene ID
    344  [NCBI]
  • Molecular Construction
    • N-term
    • APOC2 (T23-E101)
      Accession # P02655
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    APOC2; Apo-CII; Apolipoprotein C2; APO-CII; Apolipoprotein C-II; APOC-II; ApoC-II; APC2

  • AA Sequence

    TQQPQQDEMPSPTFLTQVKESLSSYWESAKTAAQNLYEKTYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE

  • Predicted Molecular Mass

    10 kDa

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of PBS, 50% Glycerol, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Chi-SunWang, et al. Isolation and characterization of recombinant human apolipoprotein C-II expressed in Escherichia coli. Biochimica et Biophysica Acta (BBA) - Lipids and Lipid Metabolism. Volume 1302, Issue 3, 16 August 1996.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • APOC2 Protein, Human (His, solution) Product Image
    1/16
  • Experimental Validation Results for APOC2 Protein, Human (His, solution)
  • APOC2 Protein, Human (His, solution) Product Image