1. Recombinant Proteins
  2. Others
  3. Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His)

Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P700660
Handling Instructions Technical Support

Apolipoprotein H/APOH proteins have multiple functions and can bind to negatively charged substances such as heparin and phospholipids. Its diverse interactions highlight the adaptability that is critical for preventing activation of the intrinsic coagulation cascade by binding to phospholipids on the surface of damaged cells. Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Apolipoprotein H/APOH protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Apolipoprotein H/APOH proteins have multiple functions and can bind to negatively charged substances such as heparin and phospholipids. Its diverse interactions highlight the adaptability that is critical for preventing activation of the intrinsic coagulation cascade by binding to phospholipids on the surface of damaged cells. Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Apolipoprotein H/APOH protein, expressed by HEK293 , with C-His labeled tag.

Background

The Apolipoprotein H/APOH protein exhibits versatile functionality as it binds to various negatively charged substances, including heparin, phospholipids, and dextran sulfate. Its interactions with these substances suggest a broad spectrum of molecular engagements, highlighting its adaptability. Notably, Apolipoprotein H/APOH may play a crucial role in preventing the activation of the intrinsic blood coagulation cascade by specifically binding to phospholipids present on the surface of damaged cells. This functionality underscores its potential contribution to the regulation of coagulation processes and its importance in maintaining hemostatic balance in response to cellular damage.

Biological Activity

Immobilized Cynomolgus APOH, His Tag at 1 or 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-APOH Antibody, hFc Tag with the EC50 of ≤65 ng/mL determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_045230479.1 (G20-C345)

Gene ID
Molecular Construction
N-term
APOH (G20-C345)
Accession # XP_045230479.1
8*His
C-term
Protein Length

Partial

Synonyms
Apo-H; B2GP1; B2G1; APOH; B2GPI; beta(2)GPI; BG; β(2)GPI;
AA Sequence

GRTCPKPDDLPFSIVVPLKTFYEPGEEITYSCKPGYVSRGGMRRFICPLTGMWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTINFSCNTGFYLNGANSAKCTEEGQWSPGIPVCAPITCPPPSVPMFATLRVYKPSAGNNSFYQDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPLRPDNGFVNYPAKPVLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC

Molecular Weight

50-65 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 100 mM Arginine, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Apolipoprotein H/APOH Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700660
Quantity:
MCE Japan Authorized Agent: