Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)

Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Arginase-1 (ARG1) stands as a central component of the urea cycle, crucial for the conversion of L-arginine to urea and L-ornithine, the latter serving as a precursor for metabolites vital in collagen synthesis and bioenergetic pathways that fuel cell proliferation. Primarily active in the liver and, to a lesser extent, in the kidneys, the urea cycle plays a pivotal role in maintaining L-arginine homeostasis, particularly in tissues where nitric oxide synthase (NOS) and arginase engage in a competitive relationship for intracellular arginine. Beyond its metabolic functions, ARG1 emerges as a critical regulator of innate and adaptive immune responses, participating in antimicrobial effector pathways in polymorphonuclear granulocytes (PMN). Upon PMN cell death, ARG1 is released, depleting arginine in the microenvironment and dampening T cell and natural killer (NK) cell proliferation as well as cytokine secretion. Notably, in group 2 innate lymphoid cells (ILC2s), ARG1 contributes to acute type 2 inflammation in the lung, influencing optimal ILC2 proliferation. Moreover, ARG1 plays a multifaceted role in the immune responses of alternatively activated or M2 macrophages, impacting processes such as wound healing, tissue regeneration, defense against multicellular pathogens, and immune suppression with outcomes varying by organ. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs), ARG1 contributes to the suppression of T cell-mediated antitumor immunity, highlighting its diverse and context-dependent immunoregulatory functions.

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Mouse

P. pastoris

N-6*His

Q61176 (M1-K323)

11846  [NCBI]

Full Length

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

Approximately 36.8 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.