Arginase-1/ARG1 Protein, Mouse (P.pastoris, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: P. pastoris
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Arginase-1 (ARG1) plays a key role in the urea cycle, converting L-arginine into urea and L-ornithine. This cycle maintains L-arginine homeostasis, which is critical for nitric oxide synthase to compete for arginine. Arginase-1/ARG1 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Arginase-1/ARG1 protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Arginase-1 (ARG1) stands as a central component of the urea cycle, crucial for the conversion of L-arginine to urea and L-ornithine, the latter serving as a precursor for metabolites vital in collagen synthesis and bioenergetic pathways that fuel cell proliferation. Primarily active in the liver and, to a lesser extent, in the kidneys, the urea cycle plays a pivotal role in maintaining L-arginine homeostasis, particularly in tissues where nitric oxide synthase (NOS) and arginase engage in a competitive relationship for intracellular arginine. Beyond its metabolic functions, ARG1 emerges as a critical regulator of innate and adaptive immune responses, participating in antimicrobial effector pathways in polymorphonuclear granulocytes (PMN). Upon PMN cell death, ARG1 is released, depleting arginine in the microenvironment and dampening T cell and natural killer (NK) cell proliferation as well as cytokine secretion. Notably, in group 2 innate lymphoid cells (ILC2s), ARG1 contributes to acute type 2 inflammation in the lung, influencing optimal ILC2 proliferation. Moreover, ARG1 plays a multifaceted role in the immune responses of alternatively activated or M2 macrophages, impacting processes such as wound healing, tissue regeneration, defense against multicellular pathogens, and immune suppression with outcomes varying by organ. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs), ARG1 contributes to the suppression of T cell-mediated antitumor immunity, highlighting its diverse and context-dependent immunoregulatory functions.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Mouse
  • Source P. pastoris
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • ARGI1 (M1-K323)
      Accession # Q61176
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    ARG1; Type I Arginase; Arginase 1; Arginase, Liver; Arginase-1; Arginase; Liver-Type Arginase

  • AA Sequence

    MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

  • Predicted Molecular Mass

    36.8 kDa

  • Molecular Weight

    Approximately 37 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00