ARL6IP6 Protein, Human (HEK293, Fc)

ARL6IP6 Protein is present in the inner nuclear membrane and displays transmembrane characteristics. ARL6IP6 gene plays a role in the activation of NF-κB and in the regulation of cell growth and apoptosis. ARL6IP6 can be used in research of cutis marmorata telangiectatica (CMTC). ARL6IP6 Protein, Human (HEK293, Fc) is the recombinant human-derived ARL6IP6 protein, expressed by HEK293 , with N-mFc labeled tag.

ADP-ribosylation factor-like protein 6-interacting protein 6 (ARL6IP6) is present in the inner nuclear membrane and displays transmembrane characteristics. ARL6IP6 gene plays a role in the activation of NF-κB and in the regulation of cell growth and apoptosis. ARL6IP6 can be used in research of cutis marmorata telangiectatica (CMTC)^[1][2][3].

Human

HEK293

N-mFc

Q8N6S5/NP_689735.1 (M1-S110)

151188  [NCBI]

Partial

MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLS

Approximately 34-53 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.