1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. GDNF family
  5. Artemin
  6. Artemin Protein, Mouse (HEK293, Fc)

Artemin Protein, a ligand for GFR-alpha-3-RET and GFR-alpha-1-RET receptor complexes, is vital for the survival of sensory, sympathetic, and dopaminergic neurons. It strongly attracts gut hematopoietic cells, promoting Peyer's patch-like structure formation in the gut-associated lymphoid tissue. Existing in a homodimeric form linked by disulfide bonds, Artemin binds to the RET receptor. Artemin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Artemin protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Artemin Protein, a ligand for GFR-alpha-3-RET and GFR-alpha-1-RET receptor complexes, is vital for the survival of sensory, sympathetic, and dopaminergic neurons. It strongly attracts gut hematopoietic cells, promoting Peyer's patch-like structure formation in the gut-associated lymphoid tissue. Existing in a homodimeric form linked by disulfide bonds, Artemin binds to the RET receptor. Artemin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Artemin protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Artemin protein functions as a ligand for the GFR-alpha-3-RET receptor complex and can also activate the GFR-alpha-1-RET receptor complex. It plays a vital role in supporting the survival of sensory and sympathetic peripheral neurons in culture and additionally supports the survival of dopaminergic neurons in the ventral mid-brain. Acting as a strong attractant for gut hematopoietic cells, Artemin promotes the formation of Peyer's patch-like structures, which are integral components of the gut-associated lymphoid tissue. The protein exists in a homodimeric form, linked by disulfide bonds, and binds to the RET receptor.

Biological Activity

Immobilized Mouse ARTN, hFc Tag at 5μg/mL (100μL/well) on the plate. Dose response curve for Mouse GFRA3, His Tag with the EC50 of 10-50 ng/mL determined by ELISA.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9Z0L2-1 (A112-G224)

Gene ID
Molecular Construction
N-term
hFc
Artemin (A112-G224)
Accession # Q9Z0L2-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Artemin; ARTN; Enovin; EVN; EVNneurotrophic factor; NBN; Neublastin
AA Sequence

AGTRSSRARTTDARGCRLRSQLVPVSALGLGHSSDELIRFRFCSGSCRRARSQHDLSLASLLGAGALRSPPGSRPISQPCCRPTRYEAVSFMDVNSTWRTVDHLSATACGCLG

Molecular Weight

Approximately 38-48 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Glycine,150 mM NaCl, pH 3.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Artemin Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Artemin Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P75584
Quantity:
MCE Japan Authorized Agent: