ATG4C Protein, Human (His)
Based on 1 Customer Validation
ATG4C Protein, Human (His) is a recombinant human Autophagy Related 4 Homolog C (Atg4C) expressed in E. coli with a His tag. Atg4C, a member of a family of cysteine proteinases, is a autophagy-regulating protease.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
ATG4C Protein, Human (His) is a recombinant human Autophagy Related 4 Homolog C (Atg4C) expressed in E. coli with a His tag. Atg4C, a member of a family of cysteine proteinases, is a autophagy-regulating protease[1].
Background
Among the four mammalian Atg4 orthologues, Atg4C is the most widely distributed in human tissues. On this basis together with the fact that human Atg4C is able to complement the deficiency of Atg4 in yeast, studies were undertaken to generate a murine model defective for the Atg4C gene. Atg4C could be involved in events associated with tumor progression[1].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q96DT6 (M1-L458)
-
Molecular Construction
-
N-term
-
ATG4C (M1-L458)
Accession # Q96DT6 -
6*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
ATG4C; HsAPG4C; Prev. APG4C; ATG4 Autophagy Related 4 Homolog C (S. Cerevisiae); Prev. AUTL1; APG4 Autophagy 4 Homolog C (S. Cerevisiae); AUTL3; Epididymis Secretory Sperm Binding Protein; Autophagy-Related Cysteine Endopeptidase 3; Autophagy Related 4C,
-
AA Sequence
MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQGITIYVAQDCTVYNSDVIDKQSASMTSDNADDKAVIILVPVRLGGERTNTDYLEFVKGILSLEYCVGIIGGKPKQSYYFAGFQDDSLIYMDPHYCQSFVDVSIKDFPLETFHCPSPKKMSFRKMDPSCTIGFYCRNVQDFKRASEEITKMLKFSSKEKYPLFTFVNGHSRDYDFTSTTTNEEDLFSEDEKKQLKRFSTEEFVLL
-
Molecular Weight
Approximately 56 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
