1. Recombinant Proteins
  2. Receptor Proteins
  3. ATP6AP2 Protein, Human (His)

ATP6AP2 Protein, Human (His)

Cat. No.: HY-P72099
COA Handling Instructions

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ATP6AP2 Protein, Human (His) is 334 a.a., with molecular weight of ~40 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $50 In-stock
10 μg $82 In-stock
50 μg $230 In-stock
100 μg $390 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The multifunctional ATP6AP2 protein serves as a cellular receptor for renin and prorenin, contributing to lysosomal V-ATPase assembly and endolysosomal acidification. It participates in renin-dependent reactions, activates ERK1/2, and may enhance the catalytic efficiency of renin in the renin-angiotensin system. ATP6AP2 Protein, Human (His) is the recombinant human-derived ATP6AP2 protein, expressed by E. coli , with N-6*His labeled tag. The total length of ATP6AP2 Protein, Human (His) is 334 a.a., with molecular weight of ~40 kDa.

Background

The ATP6AP2 protein, a multifunctional player in cellular processes, serves as a renin and prorenin cellular receptor while contributing to the assembly of the lysosomal proton-transporting V-type ATPase (V-ATPase) and acidification of the endo-lysosomal system. It is implicated in renin-dependent cellular responses, activating ERK1 and ERK2, and plays a potential role in the renin-angiotensin system (RAS) by enhancing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I. Its involvement in V-ATPase assembly and lysosomal acidification regulates protein degradation, influencing signaling pathways crucial for proper brain development, synapse morphology, and synaptic transmission. ATP6AP2 interacts with renin and functions as an accessory component of the V-ATPase protein pump. Its interactions with ATP6AP1, ATP6V0D1, TMEM9, and VMA21 further underscore its intricate role in the assembly and regulation of the V-ATPase complex. This multifaceted functionality positions ATP6AP2 as a key orchestrator in various cellular pathways.

Biological Activity

Data is not available.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

O75787 (N17-D350)

Gene ID
Molecular Construction
N-term
6*His
ATP6AP2 (N17-D350)
Accession # O75787
C-term
Synonyms
APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H+; -transporting lysosomal accessory protein 2; ATPase H+; -transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase; H+ transporting; lysosomal vacuolar proton pump; membrane sector associated protein M8 9;
AA Sequence

NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD

Molecular Weight

Approximately 40 kDa

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of Tris-based buffer, 50% Glycerol or 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

ATP6AP2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ATP6AP2 Protein, Human (His)
Cat. No.:
HY-P72099
Quantity:
MCE Japan Authorized Agent: