B7-H6 Protein, Human (Biotinylated, HEK293, Fc-Avi)

B7-H6, a distinctive monomeric protein, uniquely triggers NCR3-dependent natural killer (NK) cell activation, specifically interacting with NCR3 while avoiding engagement with other NK cell-activating receptors (NCR1, NCR2, and KLRK1). This specificity underscores B7-H6's unique role in initiating NK cell responses through the NCR3 pathway within the intricate network of NK cell activation mechanisms. B7-H6 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived B7-H6 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag. The total length of B7-H6 Protein, Human (Biotinylated, HEK293, Fc-Avi) is 238 a.a., with molecular weight of 66-90 kDa.

B7-H6, a distinctive protein, serves as a trigger for NCR3-dependent natural killer (NK) cell activation. Operating as a monomer, B7-H6 exhibits a specific interaction with NCR3, distinctly avoiding engagement with other NK cell-activating receptors, such as NCR1, NCR2, and KLRK1. This interaction highlights its unique role in initiating NK cell responses through the NCR3 pathway, showcasing its specificity in the intricate network of NK cell activation mechanisms.

Immobilized Human NKp30 Fc at 10 μg/mL (100 μL/well) can bind Biotinylated Human B7-H6 Fc-Avi with a linear range of 0.6-10 ng/mL.

Human

HEK293

C-Avi;C-hFc

Q68D85 (D25-S262)

374383  [NCBI]

Extracellular Domain

Biotin

DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFS

66-90 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4 . Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.