BAFFR/TNFRSF13C Protein, Rat (HEK293, His)

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation^[1]. BAFFR/TNFRSF13C Protein, Rat (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 62 amino acids (S10-A71) and is produced in HEK293 cells.

BAFF Receptor is expressed on all B cells (except plasma cells), including immature, transitional, mature, memory, and germinal center B cells, as well as on plasma cells^[2], while BAFF-R is also expressed on follicular helper T cells (TFH)^[3].
The amino acid sequence of human BAFF Receptor protein has low homology for mouse and rat BAFF Receptor protein.
BAFF Receptor binds to BAFF and recruits TNF receptor-associated factor 3 (TRAF-3) and TRAF-2 to the intracellular domain of BAFF-R molecules. The binding of TRAF3 to the BAFF-R reverses the inhibitory effect of unbound/cytoplasmic TRAF3 on the alternative NF-κB2 signaling pathway. It releases NF-κB-inducing kinase (NIK), which phosphorylates inhibitor of κB kinase 1 (IKK1) leading to activation of non-canonical NF-κB. BAFF-R signaling is critical for peripheral B cell survival and differentiation, germinal center formation, plasma cell survival, and IgG and IgE class switching^[2].
BAFF Receptor binds to BAFF mediates B-cell survival, proliferation, and differentiation, and involves in the formation of GCs in secondary follicles in murine models and tertiary lymphoid structures in autoimmune diseases^[3]. BAFF/BAFF-R signaling is crucial for primary B cell survival, differentiation and homeostasis^[4]. A/WySnJ mice expressing a defective BAFF-R have disrupted B cell maturation, similar to that seen in BAFF-deficient mice^[5].

Rat

HEK293

C-His

D4A281 (S10-A71)

500910  [NCBI]

Partial

SRRSRDSPVSTQCNQTECFDPLVRNCVSCELFYTPETRHASSLEPGTALQPQEGSGLRPDVA

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 85%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Rodig SJ, et al. BAFF-R, the major B cell-activating factor receptor, is expressed on most mature B cells and B-cell lymphoproliferative disorders. Hum Pathol. 2005 Oct;36(10):1113-9.  [Content Brief]

  [2]. Thompson N, et al. Exploring BAFF: its expression, receptors and contribution to the immunopathogenesis of Sjögren's syndrome. Rheumatology (Oxford). 2016 Sep;55(9):1548-55.  [Content Brief]

  [3]. Carrillo-Ballesteros FJ, et al. B-cell activating factor receptor expression is associated with germinal center B-cell maintenance. Exp Ther Med. 2019 Mar;17(3):2053-2060.  [Content Brief]

  [4]. Zheng N, et al. BAFF promotes proliferation of human mesangial cells through interaction with BAFF-R. BMC Nephrol. 2015 May 15;16:72.  [Content Brief]

  [5]. Ng LG, et al. B cell-activating factor belonging to the TNF family (BAFF)-R is the principal BAFF receptor facilitating BAFF costimulation of circulating T and B cells. J Immunol. 2004 Jul 15;173(2):807-17.  [Content Brief]

  [6]. Warnatz K, et al. B-cell activating factor receptor deficiency is associated with an adult-onset antibody deficiency syndrome in humans. Proc Natl Acad Sci U S A. 2009 Aug 18;106(33):13945-50.  [Content Brief]