1. Recombinant Proteins
  2. Cytokines and Growth Factors CAR-T related Proteins CD Antigens
  3. TNF Superfamily B Cell CD Proteins
  4. TNF Receptor Superfamily BCMA/CD269
  5. B Cell Maturation Antigen (BCMA)
  6. BCMA/TNFRSF17 Protein, Human (HEK293, His)

BCMA/TNFRSF17 Protein, Human (HEK293, His)

Cat. No.: HY-P72847
COA Handling Instructions

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
50 μg $510 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM). BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human (HEK293, His) is a recombinant protein with a C-Terminal His label, It consists of 54 amino acids (M1-A54) and is produced in HEK293 cells.

Background

BCMA is expressed preferentially by mature B lymphocytes, with minimal expression in hematopoietic stem cells or nonhematopoietic tissue[1]. BCMA is almost exclusively expressed on plasmablasts and PCs[2].
The amino acid sequence of human BCMA protein has low homology for mouse BCMA protein.
BCMA is a 184 amino acid and 20.2-kDa type III transmembrane glycoprotein, with the extracellular N terminus containing a conserved motif of 6 cysteines. BCMA has two agonist ligands: a proliferation-inducing ligand (APRIL) and B cell activating factor (BAFF). Upon binding of the ligands to BCMA, activates B cells (NF-κβ), rat sarcoma/mitogen-activated protein kinase (RAS/MAPK), and phosphoinositide-3-kinase-protein kinase B/Akt (PI3K-PKB/Akt) signaling pathway. These pathways result in proliferation stimulation by modulating cell cycle checkpoints, increasing survival by upregulating anti-apoptotic proteins, and production of cell adhesion molecules, angiogenesis factors, and immunosuppressive molecules[2].
BCMA can be used as a promising antigen to target using a variety of immuno-therapy treatments including CART cells, for MM patients[3]. BCMA markedly reduces plasma IgA, IgG, and IgM levels and splenic Ig heavy chain mRNA levels in mouse[4]. In BCMA−/− mice, the long-term survival of PCs is impaired, but lack of BCMA has no effect in short-lived PCs, B cell development, or early humoral immune response, and the splenic architecture and germinal centers appear intact in these BCMA-deficient mice[5]. BCMA overexpression significantly promotes in vivo growth of xenografted MM cells in murine models[6].

In Vitro

BCMA (human; 1 ng/mL; 24 h) blocks the activity of ARI2m cells and inhibits the IFNγ production[3].

In Vivo

BCMA (human; 1 µg; i.p.; on days -4, -2, , 2, and 4) decreases the IgA and IgM levels in C57 Bl/6 mice[4].

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized human BAFF at 2 μg/mL (100 μl/well) can bind BCMA/TNFRSF17 Protein, Human (HEK293, His) and the EC50 is 30-80 ng/mL.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q02223 (M1-A54)

Gene ID

608  [NCBI]

Synonyms
Tumor necrosis factor receptor superfamily member 17; CD269; TNFRSF17; BCM; BCMA
AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Weight

16.9&12.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BCMA/TNFRSF17 Protein, Human (HEK293, His)
Cat. No.:
HY-P72847
Quantity:
MCE Japan Authorized Agent: