pro-Beta-NGF Protein, Human (223a.a)

Pro-Beta-NGF protein plays a crucial role in the development and maintenance of the nervous system by binding to NTRK1 and NGFR receptors. Immature NGF precursors act as ligands for the SORCS2-NGFR complex, triggering signaling pathways affecting RAC1/2, the actin cytoskeleton, and neuronal growth. pro-Beta-NGF Protein, Human (223a.a) is the recombinant human-derived pro-Beta-NGF protein, expressed by E. coli , with tag free. The total length of pro-Beta-NGF Protein, Human (223a.a) is 223 a.a., with molecular weight of ~30 kDa.

The pro-Beta-NGF protein plays a crucial role in the development and maintenance of the sympathetic and sensory nervous systems. As an extracellular ligand, it engages with the NTRK1 and NGFR receptors, initiating signaling cascades that regulate neuronal proliferation, differentiation, and survival. Notably, the immature NGF precursor (proNGF) functions as a ligand for the SORCS2-NGFR heterodimeric receptor complex, activating signaling pathways that result in the inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton, and neuronal growth cone collapse. In contrast to mature NGF, proNGF promotes neuronal apoptosis in vitro. Furthermore, pro-Beta-NGF exhibits inhibitory effects on metalloproteinase-dependent proteolysis of platelet glycoprotein VI. The protein's interaction with lysophosphatidylinositol and lysophosphatidylserine, both lipid-bound and lipid-free, contributes to mast cell histamine release. The homodimeric structure of pro-Beta-NGF interacts with NTRK1, NGFR, and SORCS2, mediating various downstream effects on cellular processes. Additionally, pro-Beta-NGF binds to a receptor complex formed by SORT1 and NGFR, leading to NGF endocytosis. These intricate interactions highlight the multifaceted roles of pro-Beta-NGF in orchestrating neuronal functions and cellular responses.

Human

E. coli

Tag Free

P01138 (E19-A241)

4803  [NCBI]

EPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Approximately 30 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 250 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.