BMP-3B/GDF10 Protein, Mouse (HEK293, Fc)

Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity^[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways^[2]. BMP-3B/GDF10 Protein, Mouse (HEK293, Fc) has a total length of 110 amino acids (Q367-R476), is expressed in HEK293 cells.

Bone Morphogenetic Protein 3 (BMP-3) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-3 is a major component of osteogenin, which has osteogenic activity^[1]. BMP-3 is widely found in different animals, while the sequence in human is lowly similar to Rat (81.94%), and mouse (80.86%).
BMP-3 particularly serves as a reliable biomarker for screening colorectal cancer (CRC) because BMP-3 is hypermethylated and its protein expression is significantly reduced in cancer cell lines^[2].
BMP-3 also plays a suppressor role in carcinogenesis, suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways^[2].
BMP-3 could exert two-way regulatory effects on activin signaling in distinct cell types. BMP-3 stimulates proliferation of human mesenchymal stem cells which could be blocked by TGF-β/activin receptor kinase inhibitors^[3].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development^[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms^[5].

BMP-3 is an antagonist of osteogenic BMPs: BMP3 dorsalizes Xenopus laevis embryos, inhibits BMP2-mediated induction of Msx2 and blocks BMP2-mediated differentiation of osteoprogenitor cells into osteoblasts, which demonstrated from Bmp3(-/-) mice. Bmp-3 (-/-) mice have twice as much trabecular bone as wild-type littermates, indicating that BMP3, the most abundant BMP in adult bone, is a negative determinant of bone density^[6].

Mouse

HEK293

N-hFc

P97737 (Q367-R476)

14560  [NCBI]

Full Length of Mature Protein

QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIVPGIPEPCCVPDKMNSLGVLFLDENRNAVLKVYPNMSVETCACR

Approximately 40-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. /biology-dictionary/mz1-pc-cell.html

  [2]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542.  [Content Brief]

  [3]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095.  [Content Brief]

  [4]. Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38(1):428.  [Content Brief]

  [5]. Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1(Pt 1):S56-62.  [Content Brief]

  [6]. Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223(3):658-66.  [Content Brief]

  [7]. Daluiski A, et al. Bone morphogenetic protein-3 is a negative regulator of bone density. Nat Genet. 2001 Jan;27(1):84-8.  [Content Brief]