1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily
  4. Bone Morphogenetic Proteins (BMPs)
  5. BMP-4
  6. BMP-4 Protein, Human

Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A) to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

BMP-4 Protein, Human Featured Recommendations:

Top Publications Citing Use of Products

    BMP-4 Protein, Human purchased from MCE. Usage Cited in: Elife. 2025 Aug 28:14:RP104774.  [Abstract]

    Western blot analysis showing the protein levels of pSmad1/5/9, p16, and p21 in response to BMP4 (50 ng/mL, 3 d).

    BMP-4 Protein, Human purchased from MCE. Usage Cited in: Elife. 2025 Aug 28:14:RP104774.  [Abstract]

    Western blot analysis showing the changes in protein levels following BMP4 treatment (50ng/ml, 3 d).

    BMP-4 Protein, Human purchased from MCE. Usage Cited in: Elife. 2025 Aug 28:14:RP104774.  [Abstract]

    Senescence-associated β-galactosidase (SA-β-Gal) staining (left) and corresponding ratio analysis chart (right) following BMP4 (50ng/ml, 3d) treatment.

    BMP-4 Protein, Human purchased from MCE. Usage Cited in: Elife. 2025 Aug 28:14:RP104774.  [Abstract]

    Ki67 immunofluorescence (right) and corresponding ratio analysis chart (left) following BMP4 (50ng/ml, 3d) treatment. Scale bars, 80 μm. Enlarged scale bars, 40 μm.

    BMP-4 Protein, Human purchased from MCE. Usage Cited in: Neurosci Bull. 2020 Apr;36(4):372-384.  [Abstract]

    Intrathecal injection of rhBMP4 (2.5 μL, 1 μg/μL) decreased the percentage of newly-differentiated oligodendrocytes compared with the ESCS group.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    Bone morphogenetic protein 4 (BMP-4) is a polymorphic ligand protein belonging to the TGF-β family, which is involved in the circulation of the vascular system and can activate receptors on vascular cells[1]. BMP-4 binds to type I receptors (ALK-2/-3/-6) and type II receptors (BMPR2, ACVR2A)[2] to increase plaque formation and promote oxidative stress, endothelial dysfunction, and osteogenic differentiation through its pro-inflammatory and pro-atherogenic effects[3]. BMP-4 Protein, Human has a total length of 116 amino acids (S293-R408), is expressed in E. coli cells with tag free.

    Background

    Bone Morphogenetic Protein 4 (BMP-4) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-4 involves in the vasculature circulation and can activate receptors on vascular cells[1].
    BMP-4/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[4].
    BMP-4 is widely found in different animals, while the sequence in human is highly similar to Rat (96.81%), and mouse (97.54%).
    BMP-4 is expressed by endothelial cells (ECs) in response to hypoxia and promotes vascular SMC proliferation. Therefore it inhibits the proliferation of smooth muscle cells (SMCs) isolated from the proximal pulmonary artery while induces proliferation of SMCs isolated from distal pulmonary arteries[5].
    BMP-4 appears to be a marker and driver of vascular calcification, particularly in atherosclerosis[6].
    BMP-4 induces angiogenesis, endothelial cells (ECs) proliferation, and migration[7].
    BMP-4 is differentially expressed in calcified atherosclerotic plaques[8], serves as the linkers between atherosclerotic vascular calcification with mechanisms of normal bone formation[9].
    BMP-4 increases plaque formation via their pro-inflammatory and pro-atherogenic effects, promoting oxidative stress, endothelial dysfunction and osteogenic differentiation[3].

    In Vitro

    BMP-4 (1 ng/mL for 4-5 d; 10 ng/mL for 3-4 d; 100 ng/mL for 2 d) induces a synchronous wave of differentiation occurred, characterized by flattened, enlarged cells with reduced proliferation[10].
    BMP-4 (100 ng/mL; 7 d) initiates human embryonic stem cell differentiation to trophoblast[10].
    BMP4 (10 or 100 ng/mL; 24 h) significantly increases the number of mesenchymal condensations by approximately 50%[11].

    Biological Activity

    Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells.The ED50 for this effect is < 60 ng/mL.

    • Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.9255 ng/mL, corresponding to a specific activity is 1.08×106 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    Tag Free

    Accession

    P12644 (S293-R408)

    Gene ID

    652  [NCBI]

    Molecular Construction
    N-term
    BMP-4 (S293-R408)
    Accession # P12644
    C-term
    Protein Length

    Full Length of Mature Protein

    Synonyms
    rHuBMP-4; BMP-2B
    AA Sequence

    SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

    Predicted Molecular Mass
    13.1 kDa
    Molecular Weight

    Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 50 mM Na2CO3, 5 mM DTT, pH 11.0.
    2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 200 mM NaCL, 500 mM arginine, pH 8.0.
    3.Lyophilized from a 0.22 μm filtered solution of 0.1% TFA, 30% Acetonitrile, pH 2.5.
    Please refer to the lot-specific COA for specific buffer information.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References
    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    BMP-4 Protein, Human

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    BMP-4 Protein, Human
    Cat. No.:
    HY-P7007
    Quantity:
    MCE Japan Authorized Agent: