BMX Protein, Human (Active, sf9)

BMX proteins are nonreceptor tyrosine kinases that centrally regulate various signaling pathways that control actin dynamics, migration, proliferation, and survival. BMX participates in signal transduction of multiple receptors such as integrins, growth factor receptors, and cytokine receptors, induces BCAR1 tyrosine phosphorylation, and plays a key role in TNF-induced angiogenesis. BMX Protein, Human (sf9) is the recombinant human-derived BMX protein, expressed by sf9 insect cells , with tag free.

BMX Protein, a non-receptor tyrosine kinase, assumes central and diverse modulatory roles in various signaling pathways governing actin reorganization, cell migration, proliferation, survival, adhesion, and apoptosis. It actively participates in signal transduction initiated by growth factor receptors, cytokine receptors, G-protein coupled receptors, antigen receptors, and integrins. BMX induces tyrosine phosphorylation of BCAR1 in response to integrin regulation, facilitated by PTK2/FAK1, a pivotal mediator of integrin signaling events crucial for actin cytoskeleton regulation and cell motility. It plays a critical role in TNF-induced angiogenesis and is implicated in the signaling of TEK and FLT1 receptors, both essential for angiogenesis. BMX is indispensable for the phosphorylation and activation of STAT3, a transcription factor crucial in cell differentiation, and is involved in interleukin-6 (IL6) induced differentiation. Additionally, BMX plays a role in programming adaptive cytoprotection against extracellular stress in various cell systems, including salivary epithelial cells, brain endothelial cells, and dermal fibroblasts. Its potential involvement in the regulation of endocytosis through interaction with the endosomal protein RUFY1 and its role in the growth and differentiation of hematopoietic cells further underscore its multifaceted functions. Additionally, BMX contributes to signal transduction in endocardial and arterial endothelial cells.

Human

Sf9 insect cells

Tag Free

P51813 (E411-H675)

660

Partial

ELKREEITLLKELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQQLLSSIEPLREKDKH

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.