BSSP-4 Protein, Human (HEK293, His)
BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
BSSP-4 Protein is notable for its specific preference in cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA. This enzymatic selectivity indicates BSSP-4's potential modulation of specific peptide sequences, emphasizing its relevance in biological processes. BSSP-4 Protein, Human (HEK293, His) is the recombinant human-derived BSSP-4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The BSSP-4 protein takes center stage as it exhibits a distinct preference for cleaving the synthetic substrate H-D-Leu-Thr-Arg-pNA in comparison to tosyl-Gly-Pro-Arg-pNA. This enzymatic specificity highlights BSSP-4's selectivity in substrate recognition and cleavage, showcasing its potential role in modulating specific peptide sequences. The preference for H-D-Leu-Thr-Arg-pNA over tosyl-Gly-Pro-Arg-pNA suggests a substrate specificity that could be relevant to the protein's functional role in biological processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9GZN4 (A33-S317)
-
Molecular Construction
-
N-term
-
BSSP-4 (A33-S317)
Accession # Q9GZN4 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PRSS22; Serine Protease 26; Serine Protease 22; Tryptase Epsilon; BSSP-4; Protease, Serine S1 Family Member 22; Brain-Specific Serine Protease 4; Prosemin; HBSSP-4; PRSS26; SP001LA; BSSP4; Protease, Serine 22
-
AA Sequence
ARIPVPPACGKPQQLNRVVGGEDSTDSEWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQGGGALRAPSQGSGAAARS
-
Predicted Molecular Mass
31.6 kDa
-
Molecular Weight
Approximately 33-37 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
