BST2 Protein, Human (HEK293, His)

BST2 Protein, Human (HEK293, His) is a recombinant human bone marrow stromal antigen 2 produced in HEK293 cells. Bone marrow stromal antigen 2 (BST-2; also known as tetherin or CD317) is an IFN-inducible gene that functions to block the release of a range of nascent enveloped virions from infected host cells^[1].

Bone marrow stromal antigen 2 is induced by type I interferon produced in response to viral infections, as well as in certain cancers. Bone marrow stromal antigen 2 has been shown to be a host restriction factor of virus multiplication through its ability to physically tether budding virions and restrict viral spread^[2].

Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 1 µg/mL (100 µL/well) can bind Biotinylated Recombinant Dengue virus 4. The ED50 for this effect is 3.753 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human BST-2/Tetherin is immobilized at 1 µg/mL (100 µL/well) can bind Biotinylated Recombinant Dengue virus 4.The ED₅₀ for this effect is 3.753 μg/mL.

Human

HEK293

C-6*His

Q10589 (N49-S161)

684  [NCBI]

NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSSHHHHHH

20-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE. Due to glycosylation, the protein exhibits an apparent molecular weight of around 23-26 kDa in SDS-PAGE conducted under reducing conditions.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Mahauad-Fernandez WD, et al. Critical role for bone marrow stromal antigen 2 in acute Chikungunya virus infection. J Gen Virol. 2014;95(Pt 11):2450-2461.  [Content Brief]

  [2]. Tiwari R, et al. Beyond Tethering the Viral Particles: Immunomodulatory Functions of Tetherin (BST-2). DNA Cell Biol. 2019;38(11):1170-1177.  [Content Brief]