1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc)

BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc)

Cat. No.: HY-P76751
Handling Instructions Technical Support

BTLA/CD272 Protein, expressed on lymphocytes, is a negative regulator of antigen receptor signaling. Interacting with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, it modulates immune responses and maintains lymphocyte homeostasis. BTLA engages in cis and trans interactions with TNFRSF14; cis interactions regulate naive T cells, inhibiting trans interactions to maintain a resting state. During adaptive immune responses, predominant trans interactions provide survival signals to effector T cells. The intricate interplay highlights BTLA's multifaceted role in immune regulation. BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived BTLA/CD272 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

BTLA/CD272 Protein, expressed on lymphocytes, is a negative regulator of antigen receptor signaling. Interacting with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, it modulates immune responses and maintains lymphocyte homeostasis. BTLA engages in cis and trans interactions with TNFRSF14; cis interactions regulate naive T cells, inhibiting trans interactions to maintain a resting state. During adaptive immune responses, predominant trans interactions provide survival signals to effector T cells. The intricate interplay highlights BTLA's multifaceted role in immune regulation. BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived BTLA/CD272 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

B- and T-lymphocyte attenuator (BTLA), an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation[1][2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-hFc

Accession

EHH16054 (K31-L155)

Gene ID

/

Molecular Construction
N-term
BTLA (K31-L155)
Accession # EHH16054
hFc
C-term
Protein Length

Partial

Synonyms
B- and T-lymphocyte attenuator; CD272; BTLA
AA Sequence

KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRLWLL

Predicted Molecular Mass
41.4 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
References

BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTLA/CD272 Protein, Rhesus Macaque (HEK293, Fc)
Cat. No.:
HY-P76751
Quantity:
MCE Japan Authorized Agent: