1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens
  3. Inhibitory Checkpoint Molecules Macrophage CD Proteins
  4. BTLA BTLA/CD272
  5. BTLA/CD272 Protein, Rhesus Macaque (HEK293, His)

BTLA/CD272 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P76752
Handling Instructions Technical Support

BTLA/CD272 Protein, expressed on lymphocytes, is a negative regulator of antigen receptor signaling. Interacting with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, it modulates immune responses and maintains lymphocyte homeostasis. BTLA engages in cis and trans interactions with TNFRSF14; cis interactions regulate naive T cells, inhibiting trans interactions to maintain a resting state. During adaptive immune responses, predominant trans interactions provide survival signals to effector T cells. The intricate interplay highlights BTLA's multifaceted role in immune regulation. BTLA/CD272 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived BTLA/CD272 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

BTLA/CD272 Protein, expressed on lymphocytes, is a negative regulator of antigen receptor signaling. Interacting with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2, it modulates immune responses and maintains lymphocyte homeostasis. BTLA engages in cis and trans interactions with TNFRSF14; cis interactions regulate naive T cells, inhibiting trans interactions to maintain a resting state. During adaptive immune responses, predominant trans interactions provide survival signals to effector T cells. The intricate interplay highlights BTLA's multifaceted role in immune regulation. BTLA/CD272 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived BTLA/CD272 protein, expressed by HEK293 , with C-His labeled tag.

Background

B- and T-lymphocyte attenuator (BTLA), an inhibitory receptor expressed on lymphocytes, serves as a negative regulator of antigen receptor signaling through interactions with tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. These interactions contribute to the modulation of immune responses and the maintenance of lymphocyte homeostasis. BTLA may engage in both cis and trans interactions with TNFRSF14, with cis interactions playing a regulatory role in naive T cells, inhibiting trans interactions to maintain a resting state. In contrast, trans interactions, predominant during adaptive immune responses, provide survival signals to effector T cells. The intricate interplay between BTLA and its binding partners underscores its multifaceted role in immune regulation[1][2].

Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

EHH16054 (K31-L155)

Gene ID

/

Molecular Construction
N-term
BTLA (K31-L155)
Accession # EHH16054
His
C-term
Protein Length

Partial

Synonyms
B- and T-lymphocyte attenuator; CD272; BTLA
AA Sequence

KESCDVQLYIKRQSYHSIFAGDPFKLECPVKYCAHRPQVTWCKLNGTTCVKLEGRHTSWKQEKNLSFFILHFEPVLPSDNGSYRCSANFLSAIIESHSTTLYVTDVKSASERPSKDEMASRLWLL

Predicted Molecular Mass
19.3 kDa
Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류
References

BTLA/CD272 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

BTLA/CD272 Protein, Rhesus Macaque (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
BTLA/CD272 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P76752
수량:
MCE Japan Authorized Agent: