BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi)

BTN2A2 protein inhibits CD4 and CD8 T-cell proliferation activated by anti-CD3 antibodies. It regulates T-cell metabolism, suppressing IL2 and IFNG cytokine secretion. BTN2A2 plays a pivotal role in immune response modulation, maintaining immune homeostasis by limiting T-cell activation and effector functions. BTN2A2 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived BTN2A2 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

BTN2A2 protein functions as an inhibitor, impeding the proliferation of both CD4 and CD8 T-cells that are activated by anti-CD3 antibodies. Additionally, it exerts regulatory control over T-cell metabolism and suppresses the secretion of the cytokines IL2 and IFNG. This inhibition reflects BTN2A2's pivotal role in modulating immune responses and maintaining immune homeostasis by limiting the activation and effector functions of T-cells.

Human

HEK293

C-Avi;C-hFc

Q8WVV5 (Q33-V237)

10385  [NCBI]

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETV

Approximately 55-80 kDa, based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.