BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
BTN3A2 protein assumes a pivotal role in the adaptive immune response, specifically influencing T-cell responses. It exhibits the capability to modulate immune reactions by inhibiting the release of IFNG from activated T-cells. Furthermore, BTN3A2 forms homodimers, underscoring its functional relevance and potential impact on cellular processes in the immune system.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
P78410-1 (Q30-W248)
-
Molecular Construction
-
N-term
-
BTN3A2 (Q30-W248)
Accession # P78410-1 -
6*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
BTN3A2; Butyrophilin, Subfamily 3, Member A2; Butyrophilin Subfamily 3 Member A2; Butyrophilin Protein; BTN3.2; CD277; BT3.2; BTF3; BTF4
-
AA Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)