1. Recombinant Proteins
  2. Immune Checkpoint Proteins Biotinylated Proteins
  3. Butyrophilins
  4. BTN3A2
  5. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72346
Handling Instructions

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is 219 a.a., with molecular weight of 30-35 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

BTN3A2 protein, functioning as a homodimer, regulates T-cell responses in the adaptive immune system by inhibiting the release of IFNG from activated T-cells. BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived BTN3A2 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag. The total length of BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) is 219 a.a., with molecular weight of 30-35 kDa.

Background

BTN3A2 protein assumes a pivotal role in the adaptive immune response, specifically influencing T-cell responses. It exhibits the capability to modulate immune reactions by inhibiting the release of IFNG from activated T-cells. Furthermore, BTN3A2 forms homodimers, underscoring its functional relevance and potential impact on cellular processes in the immune system.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P78410 (Q30-W248)

Gene ID
Molecular Construction
N-term
BTN3A2 (Q30-W248)
Accession # P78410
6*His-Avi
C-term
Synonyms
Butyrophilin subfamily 3 member A2; BT3.2; BTF3; BTF4
AA Sequence

QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSNLHVEVKGYEDGGIHLECRSTGWYPQPQIQWSNAKGENIPAVEAPVVADGVGLYEVAASVIMRGGSGEGVSCIIRNSLLGLEKTASISIADPFFRSAQPW

Molecular Weight

30-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
BTN3A2 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72346
Quantity:
MCE Japan Authorized Agent: