C-MPL Protein, Rat (HEK293, Fc)

The C-MPL Protein, a receptor for thrombopoietin, is a protein encoded in humans by the oncogene of myeloproliferative leukemia virus. The C-MPL Protein is involved in the activation of the JAK/STAT/MAPK signaling pathway. C-MPL Protein is a biomarker for thrombocytopenia. C-MPL Protein, Rat (HEK293, Fc) is the recombinant rat-derived C-MPL protein, expressed by HEK293 , with C-hFc labeled tag. The total length of C-MPL Protein, Rat (HEK293, Fc) is 479 a.a., with molecular weight of ~80.7 kDa.

The thrombopoietin receptor, also known as myeloproliferative leukemia protein or CD110 (differentiated cluster 110), is a protein encoded in humans by the myeloproliferative leukemia virus oncogene. C-MPL can activate thrombopoietin receptors, participate in bone marrow cell homeostasis, and platelet aggregation and actively regulate the process of platelet formation. C-MPL is involved in the phosphorylation of < B.AK /STAT/MAPK family proteins. C-MPL is a biomarker for thrombocytopenia^[1][2][3].

Rat

HEK293

C-hFc

XP_001072502.1 (Q22-A500）

366455  [NCBI]

QVTSQDVFLLALGTEPLNCFSQTFEDLTCFWDEEEAAPSWIYQLLYAYPGEKPRPCPLHSQSVPTFGTRYVCQFPALDEVRLFFPLHLWVKNVFLNQTLMQRVLFVDTVGLPAPPSVIKARGGSQPGELQIHWEAPAPEISNFLRHELRYGPTDSSNATAPSVIQLLSTETCCPTLRMPNPVRVLDQHPCVHPTASQQHGPMRTSPAGEAPSLAVKGGSCLISGLHAGQSYWLQLRSQPDGVSLRGSWGPWSLPVTVDLPGDAVAIGLQCFTVDLKKVICQWQQQDHSSSRGFFRHSRTRCCPTDRDPTWEKCEEEEEEEEEEKEEGELDPGSRPALFSRCHFKSRNDSVIHILVEVTTAQGAIHSYLGSPFWIRQAVLLPTPSLHWREISSGRLELEWQHPSPWAAQETCYQLRYTGEGHEDWKVLEPSLGAQGGTLELRPRARYSLQLRARLNGPTYQGPWSAWSPPARVSTGSETA

Approximately 80.7 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.