C1orf33/MRTO4 Protein, Human (His)

C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.

C1orf33/MRTO4, a vital player in ribosome assembly, serves as a nuclear paralog of the ribosomal protein P0. It engages with pre-60S subunits during the initial stages of assembly within the nucleolus. Notably, in the subsequent maturation process, C1orf33/MRTO4 is displaced by P0, leading to the formation of cytoplasmic pre-60S subunits and mature 80S ribosomes. This protein actively associates with the pre-60S ribosomal particle, contributing to the intricate machinery orchestrating ribosome biogenesis. Additionally, C1orf33/MRTO4 exhibits interaction with MINAS-60, a product arising from an alternative open reading frame of RBM10, highlighting its involvement in diverse cellular processes.

Human

E. coli

N-His

Q9UKD2 (M1-D239)

51154  [NCBI]

Full Length

MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD

Approximately 32 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.