C1orf33/MRTO4 Protein, Human (His)
Based on 1 Customer Validation
C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
C1orf33/MRTO4 is an integral component of ribosome assembly, binds to the 60S presubunit in the nucleolus, and is subsequently replaced by P0 during maturation, contributing to ribosome biogenesis. It interacts with MINAS-60, a replacement for the RBM10 open reading frame. C1orf33/MRTO4 Protein, Human (His) is the recombinant human-derived C1orf33/MRTO4 protein, expressed by E. coli , with N-His labeled tag.
Background
C1orf33/MRTO4, a vital player in ribosome assembly, serves as a nuclear paralog of the ribosomal protein P0. It engages with pre-60S subunits during the initial stages of assembly within the nucleolus. Notably, in the subsequent maturation process, C1orf33/MRTO4 is displaced by P0, leading to the formation of cytoplasmic pre-60S subunits and mature 80S ribosomes. This protein actively associates with the pre-60S ribosomal particle, contributing to the intricate machinery orchestrating ribosome biogenesis. Additionally, C1orf33/MRTO4 exhibits interaction with MINAS-60, a product arising from an alternative open reading frame of RBM10, highlighting its involvement in diverse cellular processes.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9UKD2 (M1-D239)
-
Molecular Construction
-
N-term
-
His
-
C1orf33 (M1-D239)
Accession # Q9UKD2 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
MRTO4; MRT4, MRNA Turnover 4, Homolog (S. Cerevisiae); Prev. C1orf33; Chromosome 1 Open Reading Frame 33; MRT4; MRTO4 Ribosome Maturation Factor; DJ657E11.4; 60S Acidic Ribosomal Protein PO; MRNA Turnover Protein 4 Homolog; MRT4, MRNA Turnover 4, Homolog;
-
AA Sequence
MPKSKRDKKVSLTKTAKKGLELKQNLIEELRKCVDTYKYLFIFSVANMRNSKLKDIRNAWKHSRMFFGKNKVMMVALGRSPSDEYKDNLHQVSKRLRGEVGLLFTNRTKEEVNEWFTKYTEMDYARAGNKAAFTVSLDPGPLEQFPHSMEPQLRQLGLPTALKRGVVTLLSDYEVCKEGDVLTPEQARVLKLFGYEMAEFKVTIKYMWDSQSGRFQQMGDDLPESASESTEESDSEDDD
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
