Cadherin-17 Protein, Human (106a.a, HEK293, mFc)

Cadherin-17 protein mediates cell-cell interactions, sorting and organizing heterogeneous cell types by preferentially binding to other Cadherin-17 molecules. LI-cadherin, a subtype of Cadherin-17, is implicated in liver and intestinal morphological organization. Cadherin-17 also facilitates intestinal peptide transport, emphasizing its functional significance. Cadherin-17 Protein, Human (106a.a, HEK293, mFc) is the recombinant human-derived Cadherin-17 protein, expressed by HEK293, with C-mFc labeled tag.

Cadherin-17 protein, a calcium-dependent cell adhesion molecule, is involved in mediating cell-cell interactions. Through its preferential homophilic interaction with other cadherin molecules of the same type in connecting cells, Cadherin-17 contributes to the sorting and organization of heterogeneous cell types. Specifically, LI-cadherin, a subtype of Cadherin-17, may play a role in the morphological organization of the liver and intestine. Furthermore, Cadherin-17 is involved in facilitating intestinal peptide transport, highlighting its functional significance in cellular processes.

Human

HEK293

C-mFc

Q12864 (Q23-Q128)

1015

Partial

QEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDINDNRPTFLQ

Approximately 43-53 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.

• [1]. /biology-dictionary/molt-4-cell.html  [Content Brief]