1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. CALCB Protein, Human (HEK293, mFc)

CALCB, known for its vasodilatory effects, induces dilation in various vessels, encompassing the coronary, cerebral, and systemic vasculature. Its notable abundance in the central nervous system suggests a potential role as a neurotransmitter or neuromodulator, underscoring its significance in physiological processes related to vascular regulation and neural signaling. CALCB Protein, Human (HEK293, mFc) is the recombinant human-derived CALCB protein, expressed by HEK293 , with C-mFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CALCB, known for its vasodilatory effects, induces dilation in various vessels, encompassing the coronary, cerebral, and systemic vasculature. Its notable abundance in the central nervous system suggests a potential role as a neurotransmitter or neuromodulator, underscoring its significance in physiological processes related to vascular regulation and neural signaling. CALCB Protein, Human (HEK293, mFc) is the recombinant human-derived CALCB protein, expressed by HEK293 , with C-mFc labeled tag.

Background

CALCB (Calcitonin gene-related peptide beta) protein, also known as CGRP (Calcitonin Gene-Related Peptide), is a neuropeptide that plays a crucial role in inducing vasodilation. CGRP exerts its vasodilatory effects on various vessels, including those in the coronary, cerebral, and systemic vasculature. This ability to promote dilation suggests its involvement in regulating blood flow and vascular tone. Additionally, the abundance of CGRP in the central nervous system (CNS) hints at its potential roles as a neurotransmitter or neuromodulator, emphasizing its significance in neural signaling and modulation within the CNS.

Species

Human

Source

HEK293

Tag

C-mFc

Accession

P10092 (A26-F118)

Gene ID

797  [NCBI]

Molecular Construction
N-term
CALCB (A26-F118)
Accession # P10092
mFc
C-term
Protein Length

Full Length of Mature Peptide (with propeptide)

Synonyms
Calcitonin gene-related peptide 2; CALC2; Beta-CGRP; CGRP-II
AA Sequence

APFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF

Predicted Molecular Mass
36.2 kDa
Molecular Weight

Approximately 37 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CALCB Protein, Human (HEK293, mFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CALCB Protein, Human (HEK293, mFc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CALCB Protein, Human (HEK293, mFc)
Cat. No.:
HY-P75600
Quantity:
MCE Japan Authorized Agent: