Calreticulin/CALR Protein, Human (His)

Customer Review

Based on 1 Customer Validation

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag.

Background

Calreticulin/CALR protein is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by promoting folding, oligomeric assembly, and quality control. It achieves this through the calreticulin/calnexin cycle, where it interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, calreticulin/CALR protein interacts with the DNA-binding domain of NR3C1, facilitating its nuclear export. It is also involved in the regulation of maternal gene expression and may participate in oocyte maturation by regulating calcium homeostasis. During oocyte activation, calreticulin/CALR protein is exocytosed from cortical granules and potentially contributes to the blockage of polyspermy. It exists as a monomer and is part of an EIF2 complex composed of various proteins such as CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. Calreticulin/CALR protein interacts with several other proteins, including PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, GABARAP, HLA-E-B2M, HLA-G-B2M complexes, HLA-F, and CLCC1.

Verified Bioactivity

When Recombinant Human CALR is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is <15 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    When Recombinant Human CALR is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is 5.221 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CALR (E18-L417)
      Accession # P27797
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CALR; FLJ26680; Calreticulin; CRP55; Calregulin; ERp60; CC1qR; HACBP; CALR1; Grp60; SSA; Epididymis Secretory Sperm Binding Protein Li 99n; CRT; Autoantigen Ro; RO; HEL-S-99n; Sicca Syndrome Antigen A (Autoantigen Ro; Calreticulin); CRTC; Endoplasmic Reti

  • AA Sequence

    EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

  • Molecular Weight

    Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00