Calreticulin/CALR Protein, Human (His)

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag. The total length of Calreticulin/CALR Protein, Human (His) is 400 a.a., with molecular weight of ~50.6 kDa.

Calreticulin/CALR protein is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by promoting folding, oligomeric assembly, and quality control. It achieves this through the calreticulin/calnexin cycle, where it interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, calreticulin/CALR protein interacts with the DNA-binding domain of NR3C1, facilitating its nuclear export. It is also involved in the regulation of maternal gene expression and may participate in oocyte maturation by regulating calcium homeostasis. During oocyte activation, calreticulin/CALR protein is exocytosed from cortical granules and potentially contributes to the blockage of polyspermy. It exists as a monomer and is part of an EIF2 complex composed of various proteins such as CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. Calreticulin/CALR protein interacts with several other proteins, including PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, GABARAP, HLA-E-B2M, HLA-G-B2M complexes, HLA-F, and CLCC1.

Human

E. coli

N-6*His

P27797 (E18-L417)

811  [NCBI]

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Approximately 50.6 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.