1. Recombinant Proteins
  2. Others
  3. Calreticulin/CALR Protein, Human (His)

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg En stock
> 100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

The calreticulin/CALR protein is a calcium-binding molecular chaperone that promotes ER folding and quality control. It interacts with monoglucosylated glycoproteins and promotes nuclear export of NR3C1. Calreticulin/CALR Protein, Human (His) is the recombinant human-derived Calreticulin/CALR protein, expressed by E. coli , with N-6*His labeled tag.

Background

Calreticulin/CALR protein is a calcium-binding chaperone that plays a crucial role in the endoplasmic reticulum (ER) by promoting folding, oligomeric assembly, and quality control. It achieves this through the calreticulin/calnexin cycle, where it interacts transiently with almost all monoglucosylated glycoproteins synthesized in the ER. Additionally, calreticulin/CALR protein interacts with the DNA-binding domain of NR3C1, facilitating its nuclear export. It is also involved in the regulation of maternal gene expression and may participate in oocyte maturation by regulating calcium homeostasis. During oocyte activation, calreticulin/CALR protein is exocytosed from cortical granules and potentially contributes to the blockage of polyspermy. It exists as a monomer and is part of an EIF2 complex composed of various proteins such as CELF1/CUGBP1, CALR, CALR3, EIF2S1, EIF2S2, HSP90B1, and HSPA5. Calreticulin/CALR protein interacts with several other proteins, including PDIA3/ERp57, SPACA9, TRIM21, NR3C1, PPIB, PDIA5, GABARAP, HLA-E-B2M, HLA-G-B2M complexes, HLA-F, and CLCC1.

Actividad biológica

When Recombinant Human CALR is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is <15 ng/mL.

  • When Recombinant Human CALR is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-CALR Antibody. The ED50 for this effect is 5.221 ng/mL.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P27797 (E18-L417)

Gene ID

811  [NCBI]

Molecular Construction
N-term
6*His
CALR (E18-L417)
Accession # P27797
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Autoantigen RO; CALR; CALR protein; CALR_HUMAN; Calregulin; Calreticulin; cC1qR; CRP55; CRT; CRTC; Endoplasmic reticulum resident protein 60; Epididymis secretory sperm binding protein Li 99n; ERp60; FLJ26680; grp60; HACBP; HEL S 99n; RO; Sicca syndrome antigen A autoantigen Ro; calreticulin; ; Sicca syndrome antigen A; SSA
AA Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Peso molecular

Approximately 54 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

Calreticulin/CALR Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

Calreticulin/CALR Protein, Human (His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
Calreticulin/CALR Protein, Human (His)
Cat. No.:
HY-P72111
Cantidad:
MCE Japan Authorized Agent: