1. Recombinant Proteins
  2. Others
  3. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution)

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution)

Art. -Nr.: HY-P71721Y
Handling Instructions Technical Support

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit
5 μg Anfrage über Preis & Lieferzeit
10 μg Anfrage über Preis & Lieferzeit
50 μg Anfrage über Preis & Lieferzeit

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

The calreticulin/CALR protein acts as a calcium-binding partner and promotes endoplasmic reticulum folding, assembly, and quality control. It interacts with monoglucosylated glycoproteins and mediates nuclear export of the NR3C1 DNA-binding domain. Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) is the recombinant mouse-derived Calreticulin/CALR protein, expressed by P. pastoris , with N-6*His labeled tag.

Background

Calreticulin/CALR protein, a calcium-binding chaperone, orchestrates crucial functions in the endoplasmic reticulum (ER) through the calreticulin/calnexin cycle, promoting the folding, oligomeric assembly, and quality control of glycoproteins. This lectin transiently interacts with nearly all monoglucosylated glycoproteins synthesized in the ER, contributing to their proper maturation and function. Beyond its role in glycoprotein processing, CALR is involved in diverse cellular processes. It interacts with the DNA-binding domain of NR3C1, mediating its nuclear export and influencing gene expression regulation. Furthermore, CALR may play a role in oocyte maturation by regulating calcium homeostasis and participating in the cortical reaction during oocyte activation, potentially contributing to the block against polyspermy. CALR forms complexes with various proteins, including GABARAP, PDIA3/ERp57, and TRIM21, highlighting its versatile interactions within cellular pathways. It also engages in intricate protein-protein interactions with PPIB, SPACA9, and CLCC1, underscoring its involvement in diverse cellular processes and protein complexes.

Species

Mouse

Source

P. pastoris

Tag

N-6*His

Accession

P14211 (D18-L416)

Gene ID
Molecular Construction
N-term
6*His
CALR (D18-L416)
Accession # P14211
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Calr; Calreticulin; CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP
AA Sequence

DPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDLEKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQKDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL

Molekulargewicht

Approximately 48.3 kDa

Reinheit

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Dokumentation

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
Calreticulin/CALR Protein, Mouse (P.pastoris, His, solution)
Art. -Nr.:
HY-P71721Y
Menge:
MCE Japan Authorized Agent: