1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 1 (CA1)
  5. Carbonic Anhydrase 1 Protein, Human (His)

Carbonic Anhydrase 1 Protein, Human (His)

Cat. No.: HY-P7718
COA Handling Instructions

Carbonic Anhydrase 1 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg $54 In-stock
10 μg $151 In-stock
50 μg $422 In-stock
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 1 Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression[1].

Background

Carbonic anhydrase 1 (CA1) is a member of the carbonic anhydrase (CA) family that reversibly catalyzes the hydration of CO2 to form HCO3-, which then rapidly binds to calcium ions to form calcium carbonate. CA1 was also highly expressed in human AS tissues and in rat vascular smooth muscle cells (VSMCs) with β-glycerophosphate-induced calcification[1].

Biological Activity

The esterase activity is determined to be greater than 500 pmol/min/μg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

P00915 (S2-F261)

Gene ID

759  [NCBI]

Synonyms
rHuCarbonic Anhydrase 1, His; Carbonic Anhydrase 1; Carbonate Dehydratase I; Carbonic Anhydrase B; CAB; Carbonic Anhydrase I; CA1
AA Sequence

ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASFHHHHHH

Molecular Weight

25-35 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE. 

Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 12.5 mM Tris-HCl, 75 mM NaCl, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Carbonic Anhydrase 1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 1 Protein, Human (His)
Cat. No.:
HY-P7718
Quantity:
MCE Japan Authorized Agent: