Copy Link Print Information

Carbonic Anhydrase 1 Protein, Human (His, solution)

Customer Review

Based on 1 Customer Validation

Carbonic Anhydrase 1 Protein, Human (His, solution) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Carbonic Anhydrase 1 Protein, Human (His, solution)
  • Carbonic Anhydrase 1 Protein, Human (His, solution) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Carbonic Anhydrase 1 Protein, Human (His, solution) expresses in E. coli with a His tag at the N-terminus. Carbonic Anhydrase 1 (CA1) expression and CA1-mediated calcification are significantly associated with atherosclerosis (AS) progression[1].

Background

Carbonic anhydrase 1 (CA1) is a member of the carbonic anhydrase (CA) family that reversibly catalyzes the hydration of CO2 to form HCO3-, which then rapidly binds to calcium ions to form calcium carbonate. CA1 was also highly expressed in human AS tissues and in rat vascular smooth muscle cells (VSMCs) with β-glycerophosphate-induced calcification[1].

Verified Bioactivity

The esterase activity is determined to be greater than 24 pmol/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Assay Procedure

Materials
Assay buffer: 12.5 mM Tris, 75 mM NaCl, pH 7.5
Test protein: Carbonic Anhydrase 1 Protein, Human (His) (HY-P7718A)
Substrate: 4-Nitrophenylacetate (4-NPA), prepared as a 20 mM stock solution in ethanol

Procedure
1. Dilute Human CA1 to 100 ng/μL in assay buffer.
2. Dilute substrate to 2 mM in assay buffer.
3. Add 50 μL of 100 ng/μL Human CA1 to the well plate, followed by 50 μL of 2 mM substrate to initiate the reaction. Perform triplicate wells.
4. Include a substrate blank containing 50 μL assay buffer and 50 μL substrate. Perform triplicate wells.
5. Read at 400 nm wavelength for 5 minutes in kinetic mode.
6. Calculate specific activity:

     Specific Activity (pmol/min/μg) =

Adjusted Vmax* (OD/min) x Conversion Factor ** (pmol/OD)
amount of enzyme (μg)

*Adjusted for Control
**Derived using calibration standard

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-6*His
  • Accession

    P00915 (A2-F261)

  • Gene ID
    759  [NCBI]
  • Molecular Construction
    • N-term
    • CA1 (S2-F261)
      Accession # P00915
    • 6*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CA1; CA-I; Carbonic Anhydrase 1; CAB; Carbonic Anhydrase I; Epididymis Secretory Sperm Binding Protein; Cyanamide Hydratase CA1; Epididymis Secretory Protein Li 11; Carbonate Dehydratase I; Carbonic Anhydrase; Car1; HEL-S-11; Carbonic Anhydrase B

  • AA Sequence

    ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF

  • Predicted Molecular Mass

    29.9 kDa

  • Molecular Weight

    Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of 12.5 mM Tris-HCl, 75 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Lin Yuan, et al. Carbonic Anhydrase 1-Mediated Calcification Is Associated With Atherosclerosis, and Methazolamide Alleviates Its Pathogenesis [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Carbonic Anhydrase 1 Protein, Human (His, solution) Product Image
    1/16
  • Experimental Validation Results for Carbonic Anhydrase 1 Protein, Human (His, solution)
  • Carbonic Anhydrase 1 Protein, Human (His, solution) Product Image