1. Recombinant Proteins
  2. Carbonic Anhydrase 11 Protein, Human (HEK293, His)

Carbonic Anhydrase 11 Protein, Human (HEK293, His)

Cat. No.: HY-P7729
Handling Instructions

Carbonic Anhydrase 11 Protein, Human (HEK293, His) is an approximately 38.0 kDa carbonic anhydrase 11 protein with a His-flag. Carbonic anhydrases (CAs) are found in many organisms, in which they contribute to several important biological processes[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $165 Ask For Quote & Lead Time
50 μg $496 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCarbonic Anhydrase 11, His; Carbonic Anhydrase-Related Protein 11; CARP XI; Carbonic Anhydrase-Related Protein 2; CA-RP II; CA11; CARP2
Species

Human

Source

HEK 293

Accession

 O75493 (V64-R328)

Gene ID

770

Molecular Weight

Approximately 38.0 kDa

AA Sequence

HIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVELKRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQINHQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLELLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALRGNRDPRHPERRCRGPNYRLHVDGVPHGRHHHHHH

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM PB,150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Carbonic Anhydrase 11 belongs to the carbonic anhydrase (CA) family and may be involved in cell proliferation and cellular transformation. CAs are zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide and thus participate in a variety of biological and physical processes[1].
Carbonic Anhydrase 11 are found in many organisms, in which they contribute to several important biological processes. Positive signals for CARP XI can be observed in the cerebellum, cerebrum, liver, stomach, small intestine, colon, kidney, and testis[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 11 Protein, Human (HEK293, His)
Cat. No.:
HY-P7729
Quantity:
MCE Japan Authorized Agent: