2. Recombinant Proteins
  3. Enzymes & Regulators
  4. Lyases (EC 4) Carbonic Anhydrase
  5. Carbonic Anhydrase 12 (CA-XII)
  6. Carbonic Anhydrase 12 Protein, Mouse (277a.a, HEK293, His)

Carbonic Anhydrase 12 Protein, Mouse (277a.a, HEK293, His)

Cat. No.: HY-P7716
Handling Instructions

Carbonic Anhydrase 12 Protein, Mouse (HEK293, His), a recombinant Mouse Carbonic Anhydrase 12 produced in HEK293 cells, has a His tag at the N-terminus. Hypoxic tumors overexpress two carbonic anhydrases (CA), CA IX and XII, involved in complex processes connected to tumorigenesis (pH regulation, metabolism, invasion, and dissemination of the tumor).

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 12 Protein, Mouse (HEK293, His), a recombinant Mouse Carbonic Anhydrase 12 produced in HEK293 cells, has a His tag at the N-terminus. Hypoxic tumors overexpress two carbonic anhydrases (CA), CA IX and XII, involved in complex processes connected to tumorigenesis (pH regulation, metabolism, invasion, and dissemination of the tumor)[1].
Background

CAs are widespread in humans with 12 catalytically active isoforms and three acatalytic ones (CA VIII, X,and XI) known to date. Many of the catalytically activeCAs possess an excellent activity as catalysts for the reversibleCO2hydration to bicarbonate and protons, being among themost effective enzymes known in nature. CA IX and XII have been validated as antitumor/antimetastatic drug targets and may be used for imaging hypoxic tumors[1].
Species

Mouse
Source

HEK293
Tag

C-6*His
Accession

Q8CI85 (A25-S301)
Gene ID
Molecular Construction
N-term
Ca12 (A25-S301)
Accession # Q8CI85
6*His
C-term
Synonyms
rMuCarbonic Anhydrase 12, His; Carbonic anhydrase 12; Carbonate dehydratase XII; CA-XII; CA12; Carbonate dehydratase XII;
AA Sequence

APLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTDTGLSHHHHHH

Molecular Weight

35-40 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)
References

Carbonic Anhydrase 12 Protein, Mouse (277a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 12 Protein, Mouse (277a.a, HEK293, His)
Cat. No.:
HY-P7716
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.