CA12/Carbonic Anhydrase 12 Protein, Mouse (HEK293, His)
CA12/Carbonic Anhydrase 12 Protein, Mouse (HEK293, His), a recombinant Mouse Carbonic Anhydrase 12 produced in HEK293 cells, has a His tag at the N-terminus. Hypoxic tumors overexpress two carbonic anhydrases (CA), CA IX and XII, involved in complex processes connected to tumorigenesis (pH regulation, metabolism, invasion, and dissemination of the tumor).
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CA12/Carbonic Anhydrase 12 Protein, Mouse (HEK293, His), a recombinant Mouse Carbonic Anhydrase 12 produced in HEK293 cells, has a His tag at the N-terminus. Hypoxic tumors overexpress two carbonic anhydrases (CA), CA IX and XII, involved in complex processes connected to tumorigenesis (pH regulation, metabolism, invasion, and dissemination of the tumor)[1].
Background
CAs are widespread in humans with 12 catalytically active isoforms and three acatalytic ones (CA VIII, X,and XI) known to date. Many of the catalytically activeCAs possess an excellent activity as catalysts for the reversibleCO2hydration to bicarbonate and protons, being among themost effective enzymes known in nature. CA IX and XII have been validated as antitumor/antimetastatic drug targets and may be used for imaging hypoxic tumors[1].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-6*His
-
Accession
Q8CI85 (A25-S301)
-
Molecular Construction
-
N-term
-
Ca12 (A25-S301)
Accession # Q8CI85 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CA12; CDNA FLJ20151 Fis, Clone COL08412; Carbonic Anhydrase 12; Carbonic Dehydratase; Carbonic Anhydrase XII; Carbonic Anhydrase; HsT18816; CA12 Protein; Tumor Antigen HOM-RCC-3.1.3; T18816; Carbonate Dehydratase XII; CAXII; CA-XII
-
AA Sequence
APLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTDTGLS
-
Predicted Molecular Mass
32.4 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
