CA12/Carbonic Anhydrase 12 Protein, Mouse (HEK293, His)

CA12/Carbonic Anhydrase 12 Protein, Mouse (HEK293, His), a recombinant Mouse Carbonic Anhydrase 12 produced in HEK293 cells, has a His tag at the N-terminus. Hypoxic tumors overexpress two carbonic anhydrases (CA), CA IX and XII, involved in complex processes connected to tumorigenesis (pH regulation, metabolism, invasion, and dissemination of the tumor)^[1].

CAs are widespread in humans with 12 catalytically active isoforms and three acatalytic ones (CA VIII, X,and XI) known to date. Many of the catalytically activeCAs possess an excellent activity as catalysts for the reversibleCO2hydration to bicarbonate and protons, being among themost effective enzymes known in nature. CA IX and XII have been validated as antitumor/antimetastatic drug targets and may be used for imaging hypoxic tumors^[1].

Mouse

HEK293

C-6*His

Q8CI85 (A25-S301)

76459  [NCBI]

Extracellular Domain

APLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDLHSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLHLHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSANPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVFRNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTDTGLS

Approximately 35-40 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.

• [1]. Claudiu T Supuran, et al. Carbonic anhydrase inhibitors as emerging agents for the treatment and imaging of hypoxic tumors  [Content Brief]