1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Lyases (EC 4) Carbonic Anhydrase
  4. Carbonic Anhydrase 5B (CA-VB)
  5. Carbonic Anhydrase 5B Protein, Human (His)

Carbonic Anhydrase 5B Protein, Human (His)

Cat. No.: HY-P7721
COA Handling Instructions

Carbonic Anhydrase 5B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase V (CA-V) is a mitochondrial enzyme that provides bicarbonate for pyruvate carboxylase in liver and kidney.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $165 In-stock
50 μg $496 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

Carbonic Anhydrase 5B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase V (CA-V) is a mitochondrial enzyme that provides bicarbonate for pyruvate carboxylase in liver and kidney[1].

Background

Thea-CA gene family includes at least seven isoen-zymes (CA-I–VI and CA-IX) that provide bicarbonate ions andprotons for the regulation of pH homeostasis. Physiologically, CA-V is known to provide bicarbonate ionsfor the first enzyme in the urea cycle, carbamoyl-phosphatesynthetase I, and for the first step of gluconeogenesis, inwhich pyruvate carboxylase converts pyruvate into oxaloace-tate.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q9Y2D0 (C34-P317)

Gene ID
Molecular Construction
N-term
CA5B (C34-P317)
Accession # Q9Y2D0
6*His
C-term
Synonyms
rHuCarbonic Anhydrase 5B, His; Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA5B
AA Sequence

CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATPHHHHHH

Molecular Weight

Approximately 33.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filter solution of 20 mM Tris-HCl, 100 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
References

Carbonic Anhydrase 5B Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Carbonic Anhydrase 5B Protein, Human (His)
Cat. No.:
HY-P7721
Quantity:
MCE Japan Authorized Agent: