Cardiac phospholamban/PLN, Human (P.pastoris, GST)

Cardiac phospholamban (PLN) strictly regulates ATP2A2 in the cardiac sarcoplasmic reticulum, reversibly inhibits ATPase activity and affects myocardial contractility. Modulation of PLN reduces the affinity of ATPase for Ca(2+), thereby affecting calcium reuptake during muscle relaxation and maintaining cardiac calcium homeostasis. Cardiac phospholamban/PLN, Human (P.pastoris, GST) is the recombinant human-derived Cardiac phospholamban/PLN, expressed by P. pastoris , with N-GST labeled tag.

Cardiac phospholamban (PLN) is a key regulator that reversibly inhibits the activity of ATP2A2 in the cardiac sarcoplasmic reticulum by decreasing the apparent affinity of the ATPase for Ca(2+). This modulation of ATP2A2 by PLN significantly influences the contractility of the heart muscle in response to physiological stimuli, impacting calcium re-uptake during muscle relaxation and playing a crucial role in maintaining calcium homeostasis within the heart muscle. The extent of ATP2A2 inhibition is contingent on the oligomeric state of PLN, and phosphorylation of PLN alleviates ATP2A2 inhibition. PLN also exerts control over intracellular Ca(2+) levels in elongated spermatids, suggesting a potential role in germ cell differentiation. As a homopentamer, PLN interacts with various proteins, including HAX1, ATP2A2, VMP1, and S100A1, contributing to its multifaceted regulatory functions in cellular processes.

Human

P. pastoris

N-GST

P26678 (M1-L52)

5350  [NCBI]

Full Length

MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL

Approximately 33.1kDa

• 
  ≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 3% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.