Copy Link Print Information

Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His)
  • Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Carnosine Dipeptidase 1 Protein, Human (HEK293, His) is a human carnosine dipeptidase 1 protein with a his-flag, expressed in HEK293 cells. Carnosine Dipeptidase 1 is a member of the M20 metalloprotease family, encoded by the CNDP1 gene[1].

Background

Carnosine Dipeptidase 1 (CNDP1) is a member of the M20 metalloprotease family, a 57 kDa protein encoded by the CNDP1 gene. In humans, CNDP1 is secreted from the liver into the serum. In other mammals, CNDP1 is expressed exclusively within the kidney and lacks a signal peptide[1].
The function of CNDP1 is not fully defined, but it displays carboxy-and dipeptidase activity and its main substrates appear to be the dipeptides carnosine (β-alanyl-histidine) and homocarnosine (γ-aminobutyryl-L-histidine). Furthermore, this protein is shown to be reduced in metastatic prostate cancer and glioblastoma[1][2].

Verified Bioactivity

Measured by its ability to cleave carnosine (beta -Ala-L-His) in a two-step assay. The specific activity is 186.51 pmol/min/µg, as measured under the described conditions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q96KN2 (S27-L506)

  • Gene ID
    84735  [NCBI]
  • Molecular Construction
    • N-term
    • CNDP1 (S27-L506)
      Accession # Q96KN2
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CNDP1; HsT2308; Carnosine Dipeptidase 1; Carnosine Dipeptidase 1 (Metallopeptidase M20 Family); CPGL2; CNDP Dipeptidase 1; CN1; Serum Carnosinase; Glutamate Carboxypeptidase-Like Protein 2; Carnosinase 1; Beta-Ala-His Dipeptidase; MGC10825

  • AA Sequence

    SPSPPPALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHLDVQPADRGDGWLTDPYVLTEVDGKLYGRGATDNKGPVLAWINAVSAFRALEQDLPVNIKFIIEGMEEAGSVALEELVEKEKDRFFSGVDYIVISDNLWISQRKPAITYGTRGNSYFMVEVKCRDQDFHSGTFGGILHEPMADLVALLGSLVDSSGHILVPGIYDEVVPLTEEEINTYKAIHLDLEEYRNSSRVEKFLFDTKEEILMHLWRYPSLSIHGIEGAFDEPGTKTVIPGRVIGKFSIRLVPHMNVSAVEKQVTRHLEDVFSKRNSSNKMVVSMTLGLHPWIANIDDTQYLAAKRAIRTVFGTEPDMIRDGSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFAAFFLEMAQL

  • Predicted Molecular Mass

    54.9 kDa

  • Molecular Weight

    Approximately 65-78 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filter solution of 20 mM Tris-HCl, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

[1]. Michael Teufel, et al. Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase. J Biol Chem [Content Brief]

[2]. Peter Arner, et al. Circulating carnosine dipeptidase 1 associates with weight loss and poor prognosis in gastrointestinal cancer. PLoS One. 2015 Apr 21;10(4):e0123566. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His)
  • Carnosine Dipeptidase 1/CNDP1 Protein, Human (HEK293, His) Product Image