Caspase-1/CASP1 p20 Protein, Human (GST)
Based on 2 publication(s) in Google Scholar
Caspase-1/CASP1 is a thiol protease complex involved in inflammation by catalyzing the cleavage of IL1B, IL18, and Gasdermin-D (GSDMD). It activates a pro-inflammatory response, releases mature cytokines IL1B and IL18, and initiates pyroptosis through cleavage of GSDMD. Caspase-1/CASP1 Protein, Human (GST) is the recombinant human-derived Caspase-1/CASP1 protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Caspase-1/CASP1 is a thiol protease complex involved in inflammation by catalyzing the cleavage of IL1B, IL18, and Gasdermin-D (GSDMD). It activates a pro-inflammatory response, releases mature cytokines IL1B and IL18, and initiates pyroptosis through cleavage of GSDMD. Caspase-1/CASP1 Protein, Human (GST) is the recombinant human-derived Caspase-1/CASP1 protein, expressed by E. coli , with N-GST labeled tag.
Background
Caspase-1/CASP1 subunit p10 Protein, a thiol protease, intricately participates in various inflammatory processes by catalyzing the proteolytic cleavage of precursor proteins associated with inflammation. This includes interleukin-1 beta (IL1B) and interleukin 18 (IL18), pivotal inflammatory cytokines, as well as the pyroptosis inducer Gasdermin-D (GSDMD), converting them into active mature peptides. Functioning as a key initiator of cell immunity, Caspase-1 activates a pro-inflammatory response upon inflammasome complex formation, leading to the release of mature cytokines IL1B and IL18, which play critical roles in diverse inflammatory pathways. Caspase-1's activity extends to initiating pyroptosis, a programmed lytic cell death pathway, by cleaving GSDMD. Notably, unlike its cleavage of interleukins, the recognition and cleavage of GSDMD depend on an exosite interface on CASP1, emphasizing its versatile and complex regulatory roles. Moreover, Caspase-1 activates CASP7 in response to bacterial infection, promoting plasma membrane repair, and controls antiviral immunity by cleaving CGAS upon inflammasome activation during DNA virus infection. In apoptotic cells, Caspase-1 cleaves SPHK2, which remains enzymatically active extracellularly. Despite its involvement in diverse cellular processes, Caspase-1 is apoptosis inactive.
Verified Bioactivity
No Enzyme Activity.
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
-
Cells
Detection of Calpain-Mediated Beclin-1 Cleavage for Drug Discovery in Inflammatory Bowel Diseases. [Abstract]2026 May 18;15(10):917. PMID: 42193926
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
P29466 (N120-N269)
-
Molecular Construction
-
N-term
-
GST
-
CASP1 p20 (N120-N269)
Accession # P29466 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CASP1; Caspase 1, Apoptosis-Related Cysteine Peptidase (Interleukin 1, Beta, Convertase); Prev. IL1BC; CDNA FLJ59442, Highly Similar To Caspase-1; Caspase-1; CDNA FLJ58540, Highly Similar To Caspase-1; ICE; Interleukin 1-B Converting Enzyme; P45; CASP1 Ni
-
AA Sequence
NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN
-
Predicted Molecular Mass
43.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm solution of PBS, 6% Trehalose, pH 7.4 or 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)