1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Cathepsin
  4. Cathepsin X/Cathepsin Z
  5. Cathepsin Z/CTSZ Protein, Human (HEK293, His)

Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
500 μg 해외재고보유
> 500 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

Cathepsin Z/CTSZ Protein exhibits dual carboxy-monopeptidase and carboxy-dipeptidase activities, as evidenced by research. Additionally, it displays functional versatility by generating kinin potentiating peptides. Cathepsin Z/CTSZ Protein, Human (HEK293, His) is the recombinant human-derived Cathepsin Z/CTSZ protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Cathepsin Z/CTSZ Protein demonstrates both carboxy-monopeptidase and carboxy-dipeptidase activities, as indicated in research. It also possesses the ability to generate kinin potentiating peptides, showcasing its functional versatility.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, MCA-Arg-Pro-Pro-Gly-Phe-Ser-Ala-Phe-Lys(DNP)-OH. The specific activity is 3210.6 pmol/min/µg, as measured under the described conditions. (Activation description: The proenzyme needs to be activated in acid reducing buffer for an activated form.)

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q9UBR2 (G24-V303)

Gene ID

1522

Molecular Construction
N-term
CTSZ (G24-V303)
Accession # Q9UBR2
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
rHuCathepsin X, His; Cathepsin Z; Cathepsin P; Cathepsin X; CTSZ
AA Sequence

GLYFRRGQTCYRPLRGDGLAPLGRSTYPRPHEYLSPADLPKSWDWRNVDGVNYASITRNQHIPQYCGSCWAHASTSAMADRINIKRKGAWPSTLLSVQNVIDCGNAGSCEGGNDLSVWDYAHQHGIPDETCNNYQAKDQECDKFNQCGTCNEFKECHAIRNYTLWRVGDYGSLSGREKMMAEIYANGPISCGIMATERLANYTGGIYAEYQDTTYINHVVSVAGWGISDGTEYWIVRNSWGEPWGERGWLRIVTSTYKDGKGARYNLAIEEHCTFGDPIV

분자량

37-40 kDa

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

Cathepsin Z/CTSZ Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Cathepsin Z/CTSZ Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Cathepsin Z/CTSZ Protein, Human (HEK293, His)
Cat. No.:
HY-P7758A
수량:
MCE Japan Authorized Agent: